(data stored in ACNUC7421 zone)

EMBL: CP001622.PE436

CP001622.PE436       Location/Qualifiers
FT   CDS             complement(454134..455216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0439"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; KEGG: ret:RHE_CH00762
FT                   GDP-mannose 4,6-dehydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54748"
FT                   /db_xref="GOA:C6B1M9"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M9"
FT                   /inference="protein motif:TFAM:TIGR01472"
FT                   /protein_id="ACS54748.1"
FT                   /translation="MKRALITGITGQDGSYLAELLIEKGYEVHGIKRRTSLFNTDRIDH
FT                   LYQDPHDTNRRLVLHYGDMTDSSSLVRIVQQVQPDEIYNLAAQSHVAVSFEEPEYTANS
FT                   DALGALRILEAIRILGLEKKTRFYQASTSELYGLVQEIPQRETTPFYPRSPYAVAKLYA
FT                   YWITVNYREAYGIYACNGILFNHESPVRGETFVTRKITRALARIKLGLQDCLYLGNLDA
FT                   KRDWGHAKDYVEMQWLMLQQDEPEDFVIATGVQYSVREFVDAAAHEIGLPISWKGSGAE
FT                   EKGYDENGRCIVAVDPRYFRPTEVETLLGDPSKAKEKLGWEPRITFKQLVEEMMREDLK
FT                   SAERDELVKRHGFSAYDYHE"
     MKRALITGIT GQDGSYLAEL LIEKGYEVHG IKRRTSLFNT DRIDHLYQDP HDTNRRLVLH        60
     YGDMTDSSSL VRIVQQVQPD EIYNLAAQSH VAVSFEEPEY TANSDALGAL RILEAIRILG       120
     LEKKTRFYQA STSELYGLVQ EIPQRETTPF YPRSPYAVAK LYAYWITVNY REAYGIYACN       180
     GILFNHESPV RGETFVTRKI TRALARIKLG LQDCLYLGNL DAKRDWGHAK DYVEMQWLML       240
     QQDEPEDFVI ATGVQYSVRE FVDAAAHEIG LPISWKGSGA EEKGYDENGR CIVAVDPRYF       300
     RPTEVETLLG DPSKAKEKLG WEPRITFKQL VEEMMREDLK SAERDELVKR HGFSAYDYHE       360
//

If you have problems or comments...

PBIL Back to PBIL home page