(data stored in ACNUC7421 zone)

EMBL: CP001622.PE437

CP001622.PE437       Location/Qualifiers
FT   CDS             455861..456889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0440"
FT                   /product="N-acylneuraminate-9-phosphate synthase"
FT                   /EC_number="2.5.1.57"
FT                   /note="PFAM: N-acetylneuraminic acid synthase domain; SAF
FT                   domain protein; KEGG: rpe:RPE_4236 N-acetylneuraminate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54749"
FT                   /db_xref="GOA:C6B1N0"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1N0"
FT                   /inference="protein motif:PRIAM:2.5.1.57"
FT                   /protein_id="ACS54749.1"
FT                   /translation="MFRKDVLDESPFVIAEVGQNHQGDLDIAREYIRIYAFEGADAIKF
FT                   QTRNNRYLFSEDAYAAGYDSENAFAETYGAHREKLELKPEWLPILKADCEKHGVKFMST
FT                   PFDEPSLEILQQIDVDLLKVASFDLGNLPFLNRIAKLGKPVVMSIGGGKIEQIRSSVEV
FT                   VLRHHDQLAILHCVSEYPCEYNRLGLDNIEVLIKEFPDCIIGSSDHFNGTLSGPIAYMK
FT                   GARVFEKHVTLNRAWKGTDHSFALEPDGFRKFVRDIKRVRAMMPQKPADEIGNERVFKK
FT                   LGKSIIAYSDIRVGEELTLDKLSGRIFNTHYIPVRESNKVLGKTVKRDIAKGEPIQYSD
FT                   FG"
     MFRKDVLDES PFVIAEVGQN HQGDLDIARE YIRIYAFEGA DAIKFQTRNN RYLFSEDAYA        60
     AGYDSENAFA ETYGAHREKL ELKPEWLPIL KADCEKHGVK FMSTPFDEPS LEILQQIDVD       120
     LLKVASFDLG NLPFLNRIAK LGKPVVMSIG GGKIEQIRSS VEVVLRHHDQ LAILHCVSEY       180
     PCEYNRLGLD NIEVLIKEFP DCIIGSSDHF NGTLSGPIAY MKGARVFEKH VTLNRAWKGT       240
     DHSFALEPDG FRKFVRDIKR VRAMMPQKPA DEIGNERVFK KLGKSIIAYS DIRVGEELTL       300
     DKLSGRIFNT HYIPVRESNK VLGKTVKRDI AKGEPIQYSD FG                          342
//

If you have problems or comments...

PBIL Back to PBIL home page