(data stored in ACNUC7421 zone)

EMBL: CP001622.PE438

CP001622.PE438       Location/Qualifiers
FT   CDS             457037..457849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0441"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rce:RC1_3770 oxidoreductase, short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54750"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1N1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54750.1"
FT                   /translation="MNVDGIFDVSGDVVLVTGVSGQLGGEYAKAFLARNARVVGLDLRP
FT                   SAGSLVMQDEYPDNFMFCSADVTKKASLEQALQDVTGRFGTPTVLINNAAIDSPPSAPP
FT                   EENGPFEDYPEASWDKVIDVNLKGVYLSCQVFGAAMANAGKGSIINVASIYGLVSPDQS
FT                   LYEYRRKRGEVFFKPVAYSASKSGILNLTRYLATYWAKRNVRVNSLTIAGVFNNQEQDF
FT                   LDVYCSRIPIGRMASVDEYNGAMLFLASPASRYMTGSNLIIDGGWTAI"
     MNVDGIFDVS GDVVLVTGVS GQLGGEYAKA FLARNARVVG LDLRPSAGSL VMQDEYPDNF        60
     MFCSADVTKK ASLEQALQDV TGRFGTPTVL INNAAIDSPP SAPPEENGPF EDYPEASWDK       120
     VIDVNLKGVY LSCQVFGAAM ANAGKGSIIN VASIYGLVSP DQSLYEYRRK RGEVFFKPVA       180
     YSASKSGILN LTRYLATYWA KRNVRVNSLT IAGVFNNQEQ DFLDVYCSRI PIGRMASVDE       240
     YNGAMLFLAS PASRYMTGSN LIIDGGWTAI                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page