(data stored in ACNUC7421 zone)

EMBL: CP001622.PE439

CP001622.PE439       Location/Qualifiers
FT   CDS             457852..459312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0442"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: rce:RC1_3767
FT                   aldehyde dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54751"
FT                   /db_xref="GOA:C6B1N2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1N2"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACS54751.1"
FT                   /translation="MTTLRILNWINGQASHASSEGWLEKFNPHSGELLYHVADSSQDDV
FT                   EQAITAARSAFPAWAELTPVKRGQILMDIVALMKRRSDELAECIALETGKPPQDAKGET
FT                   GGAIMQAEYFAGEGMRLYARSLTSGTPGKYSHTVRQPRGVAGLIVPANTPIANIAWKTF
FT                   PALICGNTVVLKAAEDSPRIAQLFAELTKEAGLPDGVFNVVHGRGEPAGSTLVTDERVD
FT                   IISFTGSTGVGRRIAEVAGKRLARISLELGGKNPFVVCDDADLDQAVHWAALSAFSNAG
FT                   QRCAAGSRMLVFKSVYEEFRDRLTAKARSLKLGVAAGCDLGPLVSLRQQQSVLSAIERA
FT                   KEQGGQVLCGGRTPDAPELAGGYYVEPTVIDGLATTSDLSCKEVFGPVTTLHPVGSMTE
FT                   ALDVANATEYGLTAAVHTRNVDRAMWFAQRVKAGVANVNMGTYGSEPHMPFGGFGSSGN
FT                   GTREPGVEALDVYSELKNISFLVRPGML"
     MTTLRILNWI NGQASHASSE GWLEKFNPHS GELLYHVADS SQDDVEQAIT AARSAFPAWA        60
     ELTPVKRGQI LMDIVALMKR RSDELAECIA LETGKPPQDA KGETGGAIMQ AEYFAGEGMR       120
     LYARSLTSGT PGKYSHTVRQ PRGVAGLIVP ANTPIANIAW KTFPALICGN TVVLKAAEDS       180
     PRIAQLFAEL TKEAGLPDGV FNVVHGRGEP AGSTLVTDER VDIISFTGST GVGRRIAEVA       240
     GKRLARISLE LGGKNPFVVC DDADLDQAVH WAALSAFSNA GQRCAAGSRM LVFKSVYEEF       300
     RDRLTAKARS LKLGVAAGCD LGPLVSLRQQ QSVLSAIERA KEQGGQVLCG GRTPDAPELA       360
     GGYYVEPTVI DGLATTSDLS CKEVFGPVTT LHPVGSMTEA LDVANATEYG LTAAVHTRNV       420
     DRAMWFAQRV KAGVANVNMG TYGSEPHMPF GGFGSSGNGT REPGVEALDV YSELKNISFL       480
     VRPGML                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page