(data stored in ACNUC7421 zone)

EMBL: CP001622.PE44

CP001622.PE44        Location/Qualifiers
FT   CDS             complement(40307..43213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0045"
FT                   /product="UTP-GlnB uridylyltransferase, GlnD"
FT                   /EC_number="2.7.7.59"
FT                   /note="KEGG: rec:RHECIAT_CH0000427 [protein-PII]
FT                   uridylyltransferase protein; TIGRFAM: protein-P-II
FT                   uridylyltransferase; PFAM: GlnD PII-uridylyltransferase;
FT                   metal-dependent phosphohydrolase HD sub domain; amino
FT                   acid-binding ACT domain protein; DNA polymerase beta domain
FT                   protein region; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54356"
FT                   /db_xref="GOA:C6AYD2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD2"
FT                   /inference="protein motif:TFAM:TIGR01693"
FT                   /protein_id="ACS54356.1"
FT                   /translation="MQTKQAAGREPAVRHEQETAPAIAMRDLDFSNILDVELLQKQCDA
FT                   VAEANRNRPDVLRADLLAVLKKASTEGRQKAREALMADGGGLNCAYRISWLQDQITTVL
FT                   YNFATAHIFPQQKDKFAVTAVGGYGRDTLAPGSDIDLLFLFLPRPAEETHKAVEFMLYV
FT                   LWDMGFKVGHATRTVEECIALSKSDMTIRTAILEMRYICGLQRLETELESRFDKEIVTG
FT                   TGPEFIAAKLAERDERHRKAGDTRYLVEPNVKEGKGGLRDLHTLFWISKYYYHVRDQAE
FT                   LIKLGVLSKHEYRLLEKADDFLWAVRCHMHFLTGKAEERLSFDIQREIAEAFGYHTRPG
FT                   LSAVERFMKHYFLVAKDVGDLTRILCAALEDQQAKSIPGLTGVISRFTHRNRKIAGSVE
FT                   FVEDRGRIALADPEVFKRDPVNIIRLFHVADINGLEFHPDALKRVTRSLALIDTSLREN
FT                   DEANRLFMSILTSKRDPALILRRMNEAGVLGRFIPEFGKIVAMMQFNMYHHYTVDEHLI
FT                   RTVDILSEIDKGRAEDLHPLANKLMPGIEDREALYVAVLLHDIAKGRQEDHSIAGARVA
FT                   RKLCARFGLSQKQTEIVVWLIEEHLTMSMVAQTRDLTDRKTITDFADRVQSLDRLKMLL
FT                   ILTICDIRAVGPGVWNGWKGQLLRTLYYETELLLAGGFSEVSRKERANAAAEALHSALA
FT                   DWSQKDRNTYTKLHYQPYLLSVPLEDQIRHAHFIRQSDKAGQALATTVRTDSFHAITEI
FT                   TVLSPDHPRLLAVIAGACAAAGANIVDAQIFTTSDGRALDTIHVSREFTDDADELRRAA
FT                   TIGRMIEDVLSGRKRLPEVIATRARNRKKSKAFVIPPSVNITNSLSNKFTVIEVECLDR
FT                   PGLLSEITAVLSDLSLDIQSARITTFGEKVIDTFYVTDLVGQKISGDSKRANITARMKA
FT                   VMAEEEDELRERMPSGIIAPAATARTPPAAEKKAGSPI"
     MQTKQAAGRE PAVRHEQETA PAIAMRDLDF SNILDVELLQ KQCDAVAEAN RNRPDVLRAD        60
     LLAVLKKAST EGRQKAREAL MADGGGLNCA YRISWLQDQI TTVLYNFATA HIFPQQKDKF       120
     AVTAVGGYGR DTLAPGSDID LLFLFLPRPA EETHKAVEFM LYVLWDMGFK VGHATRTVEE       180
     CIALSKSDMT IRTAILEMRY ICGLQRLETE LESRFDKEIV TGTGPEFIAA KLAERDERHR       240
     KAGDTRYLVE PNVKEGKGGL RDLHTLFWIS KYYYHVRDQA ELIKLGVLSK HEYRLLEKAD       300
     DFLWAVRCHM HFLTGKAEER LSFDIQREIA EAFGYHTRPG LSAVERFMKH YFLVAKDVGD       360
     LTRILCAALE DQQAKSIPGL TGVISRFTHR NRKIAGSVEF VEDRGRIALA DPEVFKRDPV       420
     NIIRLFHVAD INGLEFHPDA LKRVTRSLAL IDTSLRENDE ANRLFMSILT SKRDPALILR       480
     RMNEAGVLGR FIPEFGKIVA MMQFNMYHHY TVDEHLIRTV DILSEIDKGR AEDLHPLANK       540
     LMPGIEDREA LYVAVLLHDI AKGRQEDHSI AGARVARKLC ARFGLSQKQT EIVVWLIEEH       600
     LTMSMVAQTR DLTDRKTITD FADRVQSLDR LKMLLILTIC DIRAVGPGVW NGWKGQLLRT       660
     LYYETELLLA GGFSEVSRKE RANAAAEALH SALADWSQKD RNTYTKLHYQ PYLLSVPLED       720
     QIRHAHFIRQ SDKAGQALAT TVRTDSFHAI TEITVLSPDH PRLLAVIAGA CAAAGANIVD       780
     AQIFTTSDGR ALDTIHVSRE FTDDADELRR AATIGRMIED VLSGRKRLPE VIATRARNRK       840
     KSKAFVIPPS VNITNSLSNK FTVIEVECLD RPGLLSEITA VLSDLSLDIQ SARITTFGEK       900
     VIDTFYVTDL VGQKISGDSK RANITARMKA VMAEEEDELR ERMPSGIIAP AATARTPPAA       960
     EKKAGSPI                                                                968
//

If you have problems or comments...

PBIL Back to PBIL home page