(data stored in ACNUC7421 zone)

EMBL: CP001622.PE440

CP001622.PE440       Location/Qualifiers
FT   CDS             459315..460085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0443"
FT                   /product="acylneuraminate cytidylyltransferase"
FT                   /note="PFAM: acylneuraminate cytidylyltransferase; KEGG:
FT                   rce:RC1_3768 acylneuraminate cytidylyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54752"
FT                   /db_xref="GOA:C6B1N3"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1N3"
FT                   /inference="protein motif:PFAM:PF02348"
FT                   /protein_id="ACS54752.1"
FT                   /translation="MTTKPRSVAFIPARSGSKRVPNKNVRPLADHPMIAYSIRAAIDSG
FT                   VFDAVICATDSEIYADIARHYGAEVPFLRAAEISTDKSPDIEWVVWMLEQLRAEGREFD
FT                   IFSILRPTSPFRLPETIQRAWQQFTAEPRADSLRAIEKCKQHPGKMWVIRENRMLPLMP
FT                   FSIGTTPWHSSQYAALPEVYAQDASLEIAWSRVPLESNSIAGESIIPFVSQGYEGFDIN
FT                   EPDDWWMAERLLATQSAVLPNISINPYNLLNRPE"
     MTTKPRSVAF IPARSGSKRV PNKNVRPLAD HPMIAYSIRA AIDSGVFDAV ICATDSEIYA        60
     DIARHYGAEV PFLRAAEIST DKSPDIEWVV WMLEQLRAEG REFDIFSILR PTSPFRLPET       120
     IQRAWQQFTA EPRADSLRAI EKCKQHPGKM WVIRENRMLP LMPFSIGTTP WHSSQYAALP       180
     EVYAQDASLE IAWSRVPLES NSIAGESIIP FVSQGYEGFD INEPDDWWMA ERLLATQSAV       240
     LPNISINPYN LLNRPE                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page