(data stored in ACNUC7421 zone)

EMBL: CP001622.PE441

CP001622.PE441       Location/Qualifiers
FT   CDS             460089..461999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0444"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: rce:RC1_3769 transketolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54753"
FT                   /db_xref="GOA:C6B1N4"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1N4"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ACS54753.1"
FT                   /translation="MGDLVGQAVEGTLYYLPYKEFQRVRAINAPREQRAALFSDMCRLN
FT                   ALYMIGRAGSGHIGSSFSSLDIVSWLLLEGMTGDDVYFSSKGHDAPGYYAALIGAGKLD
FT                   FELTHKLRQIDGLPGHPDVGTPGMVTNTGSLGMGVSKAKGMVIANRLNNRPGRIFVMTG
FT                   DGELQEGQFWESLVSAANSGLQEITVIIDHNKLQSDTFVKNVSDLGDLEAKLRAFGWCV
FT                   ARCDGNDIAAFAATLAAIQDDPRPKVIVADTVKGKGVSFMEHTSLDSDVAMYRFHSGAP
FT                   DASNYRAAAQEIMDRLQANLSSAGITELEFETLERPASAAPSEKAQRLVAAYSKALIAQ
FT                   AKKHSNLVALDADLVLDTGLIPFREQFPDRFVECGIAEQDMVSTAGGMALNGLLPIVHS
FT                   FACFLSTRPNEQIYNNATEKTKIIYVGSLAGVVPGGPGHSHQSVRDISALAAMPGMTLV
FT                   EPSCDAEVGLLLDWCVNEAPGSSYIRLISLPWEIPYSLPADYRPTNGRGLTLAEGEDVA
FT                   IIAYGPVLLSNAIAASKVLAEKHGISAKVINLPWLNHVDAEWLQSTVSACKAIVCLDNH
FT                   YVIGGQGDTIARALAEAGTGIPVKHIGITGVPPSGTNVQVLGAVGLDASAIAETVASVI
FT                   G"
     MGDLVGQAVE GTLYYLPYKE FQRVRAINAP REQRAALFSD MCRLNALYMI GRAGSGHIGS        60
     SFSSLDIVSW LLLEGMTGDD VYFSSKGHDA PGYYAALIGA GKLDFELTHK LRQIDGLPGH       120
     PDVGTPGMVT NTGSLGMGVS KAKGMVIANR LNNRPGRIFV MTGDGELQEG QFWESLVSAA       180
     NSGLQEITVI IDHNKLQSDT FVKNVSDLGD LEAKLRAFGW CVARCDGNDI AAFAATLAAI       240
     QDDPRPKVIV ADTVKGKGVS FMEHTSLDSD VAMYRFHSGA PDASNYRAAA QEIMDRLQAN       300
     LSSAGITELE FETLERPASA APSEKAQRLV AAYSKALIAQ AKKHSNLVAL DADLVLDTGL       360
     IPFREQFPDR FVECGIAEQD MVSTAGGMAL NGLLPIVHSF ACFLSTRPNE QIYNNATEKT       420
     KIIYVGSLAG VVPGGPGHSH QSVRDISALA AMPGMTLVEP SCDAEVGLLL DWCVNEAPGS       480
     SYIRLISLPW EIPYSLPADY RPTNGRGLTL AEGEDVAIIA YGPVLLSNAI AASKVLAEKH       540
     GISAKVINLP WLNHVDAEWL QSTVSACKAI VCLDNHYVIG GQGDTIARAL AEAGTGIPVK       600
     HIGITGVPPS GTNVQVLGAV GLDASAIAET VASVIG                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page