(data stored in ACNUC7421 zone)

EMBL: CP001622.PE442

CP001622.PE442       Location/Qualifiers
FT   CDS             462121..463842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0445"
FT                   /product="Capsule polysaccharide biosynthesis protein"
FT                   /note="PFAM: Capsule polysaccharide biosynthesis protein;
FT                   KEGG: rpe:RPE_4251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54754"
FT                   /db_xref="GOA:C6B1N5"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1N5"
FT                   /inference="protein motif:PFAM:PF05159"
FT                   /protein_id="ACS54754.1"
FT                   /translation="MSMHFIRRAIRFAKRVVSSKLSLQQSSAPAAAQQFSDWRRHLGTS
FT                   IDWKRALSSVSKGQEVLIATSVGGLSAATILEGMLGVALTLRGARVRFLLCDAVLPACL
FT                   HIHAGKIRDPAVITEYRLNKEICPGCIGRGRSHYGSLGLPVSYYSDFISEEERRALRKT
FT                   AREMPVSEIRGFRLKDMNLGEHAMAGTLRFFASGNLPATQEAEDVLRRYFEAALITETV
FT                   IQRYHEQFSPEVAVFHHGIYVPQGVIGEVCRAHGTRVANWQVGYRKKTFIFSHKETYHH
FT                   TLINESTDCWTDVPWSEATENEIMSYLKSRWYGSNDWIWFHDQPKHDAELIAKETGIDF
FT                   SKPTISLLTNVFWDAQLHFKANAFRDMLDWVLQSIEYFKGRPDLQLAIRIHPAEVRGAI
FT                   PSRQPLVDEIRKVYPTLPDNVYVIPPDSQVSTYVLCENSDTVVIYGTKTGVELTAMGIP
FT                   VVVAGEAWIRNKGLTMDATSPENYFDLLDRLPVGKRLDADTINRARKYAFHFFFRRFIP
FT                   IEFMEPSSNDAPYEIRINDLQDLLPGRDAGLDVLCNGILDGSEFVYPAEKYIGRTQ"
     MSMHFIRRAI RFAKRVVSSK LSLQQSSAPA AAQQFSDWRR HLGTSIDWKR ALSSVSKGQE        60
     VLIATSVGGL SAATILEGML GVALTLRGAR VRFLLCDAVL PACLHIHAGK IRDPAVITEY       120
     RLNKEICPGC IGRGRSHYGS LGLPVSYYSD FISEEERRAL RKTAREMPVS EIRGFRLKDM       180
     NLGEHAMAGT LRFFASGNLP ATQEAEDVLR RYFEAALITE TVIQRYHEQF SPEVAVFHHG       240
     IYVPQGVIGE VCRAHGTRVA NWQVGYRKKT FIFSHKETYH HTLINESTDC WTDVPWSEAT       300
     ENEIMSYLKS RWYGSNDWIW FHDQPKHDAE LIAKETGIDF SKPTISLLTN VFWDAQLHFK       360
     ANAFRDMLDW VLQSIEYFKG RPDLQLAIRI HPAEVRGAIP SRQPLVDEIR KVYPTLPDNV       420
     YVIPPDSQVS TYVLCENSDT VVIYGTKTGV ELTAMGIPVV VAGEAWIRNK GLTMDATSPE       480
     NYFDLLDRLP VGKRLDADTI NRARKYAFHF FFRRFIPIEF MEPSSNDAPY EIRINDLQDL       540
     LPGRDAGLDV LCNGILDGSE FVYPAEKYIG RTQ                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page