(data stored in ACNUC7421 zone)

EMBL: CP001622.PE443

CP001622.PE443       Location/Qualifiers
FT   CDS             463839..464504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0446"
FT                   /product="Acetyltransferase (isoleucine patch
FT                   superfamily)-like protein"
FT                   /note="KEGG: rsq:Rsph17025_4339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54755"
FT                   /db_xref="GOA:C6B2D5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2D5"
FT                   /inference="protein motif:COG:COG0110"
FT                   /protein_id="ACS54755.1"
FT                   /translation="MRPHWDHAFASGGVYQESDNWSKLLDPVFRVGERLYGQYSMRRIW
FT                   AAWKKAALLEPGVRLGGNARLINKHTRDAARIGENTVCRGIIRVERGARVDIGKEVYLG
FT                   DEAIISAMESVTIGRGTLIAHGVQIFDNTSHPIDWRGRERHFKRILGQPVDGSIEIPTA
FT                   PVSIGEHCWLGFGSAVLKGVTIGDRSIVAAGCVVTKDVPPDTLVVSSMATFIDLNKQG"
     MRPHWDHAFA SGGVYQESDN WSKLLDPVFR VGERLYGQYS MRRIWAAWKK AALLEPGVRL        60
     GGNARLINKH TRDAARIGEN TVCRGIIRVE RGARVDIGKE VYLGDEAIIS AMESVTIGRG       120
     TLIAHGVQIF DNTSHPIDWR GRERHFKRIL GQPVDGSIEI PTAPVSIGEH CWLGFGSAVL       180
     KGVTIGDRSI VAAGCVVTKD VPPDTLVVSS MATFIDLNKQ G                           221
//

If you have problems or comments...

PBIL Back to PBIL home page