(data stored in ACNUC7421 zone)

EMBL: CP001622.PE444

CP001622.PE444       Location/Qualifiers
FT   CDS             464519..465313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0447"
FT                   /product="glycosyltransferase-like protein"
FT                   /note="KEGG: dde:Dde_0428 glycosyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54756"
FT                   /db_xref="GOA:C6B2D6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2D6"
FT                   /inference="similar to AA sequence:KEGG:Dde_0428"
FT                   /protein_id="ACS54756.1"
FT                   /translation="MLATQQMPQYSVMDQFVESICYRAPENRTQWYPPLMRSAESLGKR
FT                   AISADAAEDALAVLRKLEPDDYSEYLSAYYAEGIRRFGANWRYADIVTVLLALAVDLKP
FT                   KSYLEIGVRRGRSVCTVASKAPTCDIYMFDMWVANYAGMENPGESLVSSELDKVSHTGK
FT                   RVFTNGNSHSTLKTFFRQNSDLAFDMITVDGDHTRNGAIEDLCDVLPRLKIGGAVVFDD
FT                   ICHPKHRYLEDVWKELVVNDNRFTSWSCADIGYGVGFALRKW"
     MLATQQMPQY SVMDQFVESI CYRAPENRTQ WYPPLMRSAE SLGKRAISAD AAEDALAVLR        60
     KLEPDDYSEY LSAYYAEGIR RFGANWRYAD IVTVLLALAV DLKPKSYLEI GVRRGRSVCT       120
     VASKAPTCDI YMFDMWVANY AGMENPGESL VSSELDKVSH TGKRVFTNGN SHSTLKTFFR       180
     QNSDLAFDMI TVDGDHTRNG AIEDLCDVLP RLKIGGAVVF DDICHPKHRY LEDVWKELVV       240
     NDNRFTSWSC ADIGYGVGFA LRKW                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page