(data stored in ACNUC7421 zone)

EMBL: CP001622.PE445

CP001622.PE445       Location/Qualifiers
FT   CDS             465307..466230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0448"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: dvm:DvMF_1854
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54757"
FT                   /db_xref="GOA:C6B2D7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2D7"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACS54757.1"
FT                   /translation="MVNTSERLLVLGASGFLGTVISTYFSSLGIPVMGIDVVPPQDKHI
FT                   YSDFYQSERMEEILETALARHQPTYLVHVAGNANVGRSIEDPRYDFVNSVDLFSLVLDQ
FT                   VRRVSLGTKVLFTSSAAVYGQPKVLPITEELAPSPISPYGYHKWMCEQLSREYSSLYEV
FT                   SVASIRIFSAYGAGLRKQILWDLCEKCRSDGPVQLGGDGSETRDFIHAKDIARAISCVV
FT                   RGGTFNGEVYNVASGVETSISDLAHHVLSAYGIPFDRLGFSGSSRVGDPKNWRADVSRL
FT                   EALGFSPTIDFVAGVAEYVDWYKKLR"
     MVNTSERLLV LGASGFLGTV ISTYFSSLGI PVMGIDVVPP QDKHIYSDFY QSERMEEILE        60
     TALARHQPTY LVHVAGNANV GRSIEDPRYD FVNSVDLFSL VLDQVRRVSL GTKVLFTSSA       120
     AVYGQPKVLP ITEELAPSPI SPYGYHKWMC EQLSREYSSL YEVSVASIRI FSAYGAGLRK       180
     QILWDLCEKC RSDGPVQLGG DGSETRDFIH AKDIARAISC VVRGGTFNGE VYNVASGVET       240
     SISDLAHHVL SAYGIPFDRL GFSGSSRVGD PKNWRADVSR LEALGFSPTI DFVAGVAEYV       300
     DWYKKLR                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page