(data stored in ACNUC7421 zone)

EMBL: CP001622.PE446

CP001622.PE446       Location/Qualifiers
FT   CDS             466227..467411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0449"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   ret:RHE_CH00756 alpha-glycosyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54758"
FT                   /db_xref="GOA:C6B2D8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2D8"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACS54758.1"
FT                   /translation="MKILIYLTGGTHWIGGVQYTRNLLRAVSLLPAQERPALVLQIGRK
FT                   NAGQGYEEEFSHYPGVVIDGPLERGSAIRSRILDLARRAWKRSTGKDLRQKLLHSDECD
FT                   VAFPAKGPNIPGLAQKVYWVPDFQYKHFPQFFSEDERRSRDAFYGKMFDESGILVLSSE
FT                   AVKADFIRFFPTYSQKPVRILHFSSTLHDEEYALDPVAVCAKHGLPEKFVYLPNQMWQH
FT                   KGFDAAFRALGILKRAGVIIPLVLTGSSEDYRSNDYARQLEEILTEYDLQDQIYRLGVL
FT                   PRSEQLQLFRRAAVVLQPSRFEGWSTTVEDTRALGRPIVLSNIDVHLEQAPPNASYFVV
FT                   GDQKDLADKLGKAWLTAEAGPDFKQEDAARKAANLNSLAYARTFLSIMRQAHRE"
     MKILIYLTGG THWIGGVQYT RNLLRAVSLL PAQERPALVL QIGRKNAGQG YEEEFSHYPG        60
     VVIDGPLERG SAIRSRILDL ARRAWKRSTG KDLRQKLLHS DECDVAFPAK GPNIPGLAQK       120
     VYWVPDFQYK HFPQFFSEDE RRSRDAFYGK MFDESGILVL SSEAVKADFI RFFPTYSQKP       180
     VRILHFSSTL HDEEYALDPV AVCAKHGLPE KFVYLPNQMW QHKGFDAAFR ALGILKRAGV       240
     IIPLVLTGSS EDYRSNDYAR QLEEILTEYD LQDQIYRLGV LPRSEQLQLF RRAAVVLQPS       300
     RFEGWSTTVE DTRALGRPIV LSNIDVHLEQ APPNASYFVV GDQKDLADKL GKAWLTAEAG       360
     PDFKQEDAAR KAANLNSLAY ARTFLSIMRQ AHRE                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page