(data stored in ACNUC7421 zone)

EMBL: CP001622.PE447

CP001622.PE447       Location/Qualifiers
FT   CDS             467449..468279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0450"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: sfu:Sfum_3355
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54759"
FT                   /db_xref="GOA:C6B2D9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2D9"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACS54759.1"
FT                   /translation="MKNQEKITYIKPAGRFAKIDLEEHWRARYMFTMLVWKKIRASFGE
FT                   MYFWFIWVCAKPLLYVMIFSLFKHWSQARTGVEIPYVLYIYSGLILWYYFLETAIDVSL
FT                   NIKANAALVTKIYLPRMITPTVPLLANLMDLAISMIPLILMMIYYGVYPGWQILMIIPT
FT                   LLVVMITAMGTGLIIATITLRLRDFQKIFEFSLYLAMFISPVIFSPSMIPEAFHWVYHM
FT                   NPMVGALIGWREALFGSASFPWGAWVYSCSFAVLALIVGLYLYLRFEHEMIEAI"
     MKNQEKITYI KPAGRFAKID LEEHWRARYM FTMLVWKKIR ASFGEMYFWF IWVCAKPLLY        60
     VMIFSLFKHW SQARTGVEIP YVLYIYSGLI LWYYFLETAI DVSLNIKANA ALVTKIYLPR       120
     MITPTVPLLA NLMDLAISMI PLILMMIYYG VYPGWQILMI IPTLLVVMIT AMGTGLIIAT       180
     ITLRLRDFQK IFEFSLYLAM FISPVIFSPS MIPEAFHWVY HMNPMVGALI GWREALFGSA       240
     SFPWGAWVYS CSFAVLALIV GLYLYLRFEH EMIEAI                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page