(data stored in ACNUC7421 zone)

EMBL: CP001622.PE448

CP001622.PE448       Location/Qualifiers
FT   CDS             468284..469552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0451"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rpe:RPE_4248 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54760"
FT                   /db_xref="GOA:C6B2E0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029439"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54760.1"
FT                   /translation="MAESVIEVFDISKQYEIGSGGGLSMSKLARETALWPYRKMRGQSV
FT                   PPLYRKRQNFWPLRDVSFSVDRGEVVGIIGANGAGKSTLLKILSRIVTPTSGSATIRGR
FT                   VSSLIEVGTGFNANLSGRENVFLNASLHGLSREEVAARFDEIVDFSGVGKFIDTPVKHY
FT                   SSGMYSRLAFSVAAHLDPDLLFVDEVLAVGDMAFQQKCLNRFSEMVGGNRTVLFVSHNL
FT                   SAVSNICSKVLWLDQGRVRYFGPTEEGIAAYYEATMPSTAQTLETRFDRTGTGDFMFNK
FT                   ISFYDSSMQPSERVTTGQELIIGLEYRAKLEMIGDIRDMSLVVIFKNDKGHRLFGLPSD
FT                   VLAHGETPRLTETGEYLVKIPSLPLLPGIYDLDLGCIINRATTDKIVSAKRLIVTESDF
FT                   FGSGKLPPVQQGDLLVRFDNEWR"
     MAESVIEVFD ISKQYEIGSG GGLSMSKLAR ETALWPYRKM RGQSVPPLYR KRQNFWPLRD        60
     VSFSVDRGEV VGIIGANGAG KSTLLKILSR IVTPTSGSAT IRGRVSSLIE VGTGFNANLS       120
     GRENVFLNAS LHGLSREEVA ARFDEIVDFS GVGKFIDTPV KHYSSGMYSR LAFSVAAHLD       180
     PDLLFVDEVL AVGDMAFQQK CLNRFSEMVG GNRTVLFVSH NLSAVSNICS KVLWLDQGRV       240
     RYFGPTEEGI AAYYEATMPS TAQTLETRFD RTGTGDFMFN KISFYDSSMQ PSERVTTGQE       300
     LIIGLEYRAK LEMIGDIRDM SLVVIFKNDK GHRLFGLPSD VLAHGETPRL TETGEYLVKI       360
     PSLPLLPGIY DLDLGCIINR ATTDKIVSAK RLIVTESDFF GSGKLPPVQQ GDLLVRFDNE       420
     WR                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page