(data stored in ACNUC7421 zone)

EMBL: CP001622.PE449

CP001622.PE449       Location/Qualifiers
FT   CDS             469568..470608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0452"
FT                   /product="O-methyltransferase family 3"
FT                   /note="PFAM: O-methyltransferase family 3; KEGG:
FT                   rpe:RPE_4247 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54761"
FT                   /db_xref="GOA:C6B2E1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E1"
FT                   /inference="protein motif:PFAM:PF01596"
FT                   /protein_id="ACS54761.1"
FT                   /translation="MNKIFDRTKLWLLDYLLRDDWNDGNNKVAKFDAQKALKGLENMKA
FT                   GRILLKQFVEVLFSSGAMIGRIERILQSMRIPTYLLMHSVLAKCLLLLDVHPKARLAEL
FT                   HAAGMLEEEFGIALNTHLAAVAFEKTRQISKIRELYAEEIFDGISRISLPLSISNEASH
FT                   HENHMDMMFVVAAAKHRGAKRIFEFGTYMGRTTVGLASIDADATVTTLNLDPAEDTRYG
FT                   PYIGKLIKDSPYRDRITQIFSDSKKFDTTPYAKSMDYIFIDADHSYDAVKNDTEKSLEM
FT                   LAPGGVIIWHDYAPKSPGVFGYLQELSLQRSLFRIRNTCLVLYIDGVDADEFEPKSDAG
FT                   FLEDVS"
     MNKIFDRTKL WLLDYLLRDD WNDGNNKVAK FDAQKALKGL ENMKAGRILL KQFVEVLFSS        60
     GAMIGRIERI LQSMRIPTYL LMHSVLAKCL LLLDVHPKAR LAELHAAGML EEEFGIALNT       120
     HLAAVAFEKT RQISKIRELY AEEIFDGISR ISLPLSISNE ASHHENHMDM MFVVAAAKHR       180
     GAKRIFEFGT YMGRTTVGLA SIDADATVTT LNLDPAEDTR YGPYIGKLIK DSPYRDRITQ       240
     IFSDSKKFDT TPYAKSMDYI FIDADHSYDA VKNDTEKSLE MLAPGGVIIW HDYAPKSPGV       300
     FGYLQELSLQ RSLFRIRNTC LVLYIDGVDA DEFEPKSDAG FLEDVS                      346
//

If you have problems or comments...

PBIL Back to PBIL home page