(data stored in ACNUC7421 zone)

EMBL: CP001622.PE45

CP001622.PE45        Location/Qualifiers
FT   CDS             complement(43368..43643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000428 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54357"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000428"
FT                   /protein_id="ACS54357.1"
FT                   /translation="MFMEKLVRETERLSLICSMLDTMRRADKDRNARGWTSPIGMLKIT
FT                   RCCAVISELGTSIAKAGYRECDRQALEEIMRETRQVLHLLNARAAG"
     MFMEKLVRET ERLSLICSML DTMRRADKDR NARGWTSPIG MLKITRCCAV ISELGTSIAK        60
     AGYRECDRQA LEEIMRETRQ VLHLLNARAA G                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page