(data stored in ACNUC7421 zone)

EMBL: CP001622.PE450

CP001622.PE450       Location/Qualifiers
FT   CDS             470623..471375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0453"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   rpe:RPE_3384 methyltransferase FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54762"
FT                   /db_xref="GOA:C6B2E2"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E2"
FT                   /inference="protein motif:TFAM:TIGR01444"
FT                   /protein_id="ACS54762.1"
FT                   /translation="MTANSHEYPVAVDDQQFLVRCINDVERGRAASFLSKEPETVRWLK
FT                   AEMVPATVFWDVGANVGLFSLYAAILQPTAQILAFEPAAHNYASLCDNIVINGFTNIVP
FT                   FSVALGQGNLAFDELHLSKVEAGSSIHHVGAKSPWAESEPVFRQPCVKVSIDSMVLDHD
FT                   FPPPTLLKIDVDGLELGILDGARTVLNQVKSVLVELDANDPSEISAATNLLEQAGFRLT
FT                   ETSRREKTINRKLPRNHIWMNAALRPLD"
     MTANSHEYPV AVDDQQFLVR CINDVERGRA ASFLSKEPET VRWLKAEMVP ATVFWDVGAN        60
     VGLFSLYAAI LQPTAQILAF EPAAHNYASL CDNIVINGFT NIVPFSVALG QGNLAFDELH       120
     LSKVEAGSSI HHVGAKSPWA ESEPVFRQPC VKVSIDSMVL DHDFPPPTLL KIDVDGLELG       180
     ILDGARTVLN QVKSVLVELD ANDPSEISAA TNLLEQAGFR LTETSRREKT INRKLPRNHI       240
     WMNAALRPLD                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page