(data stored in ACNUC7421 zone)

EMBL: CP001622.PE451

CP001622.PE451       Location/Qualifiers
FT   CDS             471455..472354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0454"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG: glycosyl
FT                   transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54763"
FT                   /db_xref="GOA:C6B2E3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACS54763.1"
FT                   /translation="MEHQLSIVLGTYNRLDQLQRCVESIVSQTKTVFRLYVTDAGSTDG
FT                   TVEYLQSIAGENIIPVLVGKKLGQAKAYNDVFNIVTTPYVCWLSDDNEVIDHGLDRAVS
FT                   IIRTDPSIGMVALKTKDLQGPFVDAPFIGGVSSTGILNVNQGLLPTALLKKIGGFSEEF
FT                   RDYGIDNALTAEVLFAGYKVVYSRKVALQHYRNWSEDPTSENYQWLKQRHEAAKVLYEE
FT                   RYGNQNTQELSGSYRMKTKVARRVKAGAKRYLTSDYVRTSAAVRTCFIILSSRYISILD
FT                   PILTFGRDYHLVQKRRTG"
     MEHQLSIVLG TYNRLDQLQR CVESIVSQTK TVFRLYVTDA GSTDGTVEYL QSIAGENIIP        60
     VLVGKKLGQA KAYNDVFNIV TTPYVCWLSD DNEVIDHGLD RAVSIIRTDP SIGMVALKTK       120
     DLQGPFVDAP FIGGVSSTGI LNVNQGLLPT ALLKKIGGFS EEFRDYGIDN ALTAEVLFAG       180
     YKVVYSRKVA LQHYRNWSED PTSENYQWLK QRHEAAKVLY EERYGNQNTQ ELSGSYRMKT       240
     KVARRVKAGA KRYLTSDYVR TSAAVRTCFI ILSSRYISIL DPILTFGRDY HLVQKRRTG        299
//

If you have problems or comments...

PBIL Back to PBIL home page