(data stored in ACNUC7421 zone)

EMBL: CP001622.PE452

CP001622.PE452       Location/Qualifiers
FT   CDS             472699..474471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0455"
FT                   /product="Capsule polysaccharide biosynthesis protein"
FT                   /note="PFAM: Capsule polysaccharide biosynthesis protein;
FT                   KEGG: rpe:RPE_4251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54764"
FT                   /db_xref="GOA:C6B2E4"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E4"
FT                   /inference="protein motif:PFAM:PF05159"
FT                   /protein_id="ACS54764.1"
FT                   /translation="MKYRHPIAALTVPTRPLLSRIRDRLSRHGWYRRFHLAYVRWRARH
FT                   GGLPDWAAWQPQAGLEPVRPPLIDGAKRVLVATGTAGHLPSMTMESLLGMALAIRDASI
FT                   DFLICDAALPACMMCEISWYSDVDKLAKHGPKDRCLTCYRPSAEMLDRAGLNAIGLNSK
FT                   LTDADRFKAKTTSTQMPQSEIAAYIEDGIPIGEHAVAGALRFFSRGDLEKVSGADVILR
FT                   RYLEAAILTYYGTRRLLAEGHYDAVVLNHGIYVPQGIISETARHLGVRVVTWHPAYRRG
FT                   CFIFNHHETYHHGLMTEPVSSWEDMSWNGMQQQQITQYLRSRWVGQQDWVKFHDQPEFD
FT                   TRSIEEEIGIDFRRPTIGLLTNVIWDAQLHYKANAFPNMVDWLIKTIAYFEKRPDLQLL
FT                   IRVHPAELTGTLPSRQPAVDEIRRQFPNLPANVFIIPPESKASTYVAMSHCNAVLIYGT
FT                   KMGVELSAMGIPVIVAGEAWIRGKGVTMDATSEENYLRLLDALPLRERLNDATIERAQK
FT                   YAYHFFFRRMVPLDCIKERKGWPPFAVHIDSLDDLAPGKSPGLDIVCNGIIAGTPFIYP
FT                   AEDLMGAPSDRRAT"
     MKYRHPIAAL TVPTRPLLSR IRDRLSRHGW YRRFHLAYVR WRARHGGLPD WAAWQPQAGL        60
     EPVRPPLIDG AKRVLVATGT AGHLPSMTME SLLGMALAIR DASIDFLICD AALPACMMCE       120
     ISWYSDVDKL AKHGPKDRCL TCYRPSAEML DRAGLNAIGL NSKLTDADRF KAKTTSTQMP       180
     QSEIAAYIED GIPIGEHAVA GALRFFSRGD LEKVSGADVI LRRYLEAAIL TYYGTRRLLA       240
     EGHYDAVVLN HGIYVPQGII SETARHLGVR VVTWHPAYRR GCFIFNHHET YHHGLMTEPV       300
     SSWEDMSWNG MQQQQITQYL RSRWVGQQDW VKFHDQPEFD TRSIEEEIGI DFRRPTIGLL       360
     TNVIWDAQLH YKANAFPNMV DWLIKTIAYF EKRPDLQLLI RVHPAELTGT LPSRQPAVDE       420
     IRRQFPNLPA NVFIIPPESK ASTYVAMSHC NAVLIYGTKM GVELSAMGIP VIVAGEAWIR       480
     GKGVTMDATS EENYLRLLDA LPLRERLNDA TIERAQKYAY HFFFRRMVPL DCIKERKGWP       540
     PFAVHIDSLD DLAPGKSPGL DIVCNGIIAG TPFIYPAEDL MGAPSDRRAT                  590
//

If you have problems or comments...

PBIL Back to PBIL home page