(data stored in ACNUC7421 zone)

EMBL: CP001622.PE453

CP001622.PE453       Location/Qualifiers
FT   CDS             474468..475568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0456"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bov:BOV_0533 putative mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54765"
FT                   /db_xref="GOA:C6B2E5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E5"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACS54765.1"
FT                   /translation="MRISIDATGLGGPKTGTSVYLIEILSRWSRNTSINHEFTIFASEK
FT                   AVSLCSEAGLDHRFRFVRAPNNRHIRVIWQQLMIPWHMRRLGIDVHWGTAFVLPVASQR
FT                   PMAVTIHDLTFQLFPEVHERLKRFYFPAIMQRSVAKAQAVFAVSRTTETDLKRIIPESR
FT                   GKTTVTLLAARKLGSDSQAPRDQRNSGDYLLFVGTLEPRKNLPRLLAAWQMLDDATRGN
FT                   TRLVIVGATGWMVSDLLQSLKTNDTIDFLGHVSDSSLAELMQGARALLYPSLYEGFGLP
FT                   VVEAMARGIPLLTSNTGATAEIAEGAAILVDPTNVDDIRGGLVRLLTEPELLGALSAQG
FT                   RERAKSFSWERTAQLTLETLEGLKRA"
     MRISIDATGL GGPKTGTSVY LIEILSRWSR NTSINHEFTI FASEKAVSLC SEAGLDHRFR        60
     FVRAPNNRHI RVIWQQLMIP WHMRRLGIDV HWGTAFVLPV ASQRPMAVTI HDLTFQLFPE       120
     VHERLKRFYF PAIMQRSVAK AQAVFAVSRT TETDLKRIIP ESRGKTTVTL LAARKLGSDS       180
     QAPRDQRNSG DYLLFVGTLE PRKNLPRLLA AWQMLDDATR GNTRLVIVGA TGWMVSDLLQ       240
     SLKTNDTIDF LGHVSDSSLA ELMQGARALL YPSLYEGFGL PVVEAMARGI PLLTSNTGAT       300
     AEIAEGAAIL VDPTNVDDIR GGLVRLLTEP ELLGALSAQG RERAKSFSWE RTAQLTLETL       360
     EGLKRA                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page