(data stored in ACNUC7421 zone)

EMBL: CP001622.PE454

CP001622.PE454       Location/Qualifiers
FT   CDS             475565..476308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0457"
FT                   /product="glycosyl transferase family protein"
FT                   /note="KEGG: neu:NE0499 glycosyl transferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54766"
FT                   /db_xref="GOA:C6B2E6"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E6"
FT                   /inference="similar to AA sequence:KEGG:NE0499"
FT                   /protein_id="ACS54766.1"
FT                   /translation="MSDICVSIVSHGQGEIANLLLDDLDSRCSGLNVVLTKNIPEELPI
FT                   RDRRYPFLQIENPSPKGFAANHNQAFRRCDSGLFCVANPDIRLQADPFGHLKAAMSDPR
FT                   VGLVAPLIVNPGGTIEDSARYFPTPFGLLRKALGKSDGRFPIDPNRSSAVDWTAGMFML
FT                   FRSEAFAEVGGFDEGFFLYYEDVDICARLWKAGWKVILLPTVSVVHDARRASHADAKYM
FT                   RWHVSSMMRYFTKHLGRTPDISRMT"
     MSDICVSIVS HGQGEIANLL LDDLDSRCSG LNVVLTKNIP EELPIRDRRY PFLQIENPSP        60
     KGFAANHNQA FRRCDSGLFC VANPDIRLQA DPFGHLKAAM SDPRVGLVAP LIVNPGGTIE       120
     DSARYFPTPF GLLRKALGKS DGRFPIDPNR SSAVDWTAGM FMLFRSEAFA EVGGFDEGFF       180
     LYYEDVDICA RLWKAGWKVI LLPTVSVVHD ARRASHADAK YMRWHVSSMM RYFTKHLGRT       240
     PDISRMT                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page