(data stored in ACNUC7421 zone)

EMBL: CP001622.PE455

CP001622.PE455       Location/Qualifiers
FT   CDS             476561..477409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0458"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIA;
FT                   HAD-superfamily subfamily IIA hydrolase like protein; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   ret:RHE_CH00830 putative hydrolase, haloacid
FT                   dehalogenase-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54767"
FT                   /db_xref="GOA:C6B2E7"
FT                   /db_xref="InterPro:IPR006356"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E7"
FT                   /inference="protein motif:TFAM:TIGR01460"
FT                   /protein_id="ACS54767.1"
FT                   /translation="MAKRIENFSEISGHYDVVLCDVWGVVHNGVDPFPKAAAALEAARE
FT                   AGLAVVLITNSPRLSWQVVEQLRQIGVPDSAYDRIVTSGDVTRGLIAEGPKTVFLLGHE
FT                   RNSPLLDGLDIERRPAGEAQSLVCTGFFDDETEKPEDYTDMLLDFKARDVPMICANPDL
FT                   IVERGHRIIPCAGAIAAYYEQLGGSTRIAGKPHRPIYEATLAAARELRGDFPVDRVLAI
FT                   GDGMPTDVRGALNYGLDLLYISGGIHAKEYTLNGETDEAILNAYLERENAAPKWWMPRL
FT                   A"
     MAKRIENFSE ISGHYDVVLC DVWGVVHNGV DPFPKAAAAL EAAREAGLAV VLITNSPRLS        60
     WQVVEQLRQI GVPDSAYDRI VTSGDVTRGL IAEGPKTVFL LGHERNSPLL DGLDIERRPA       120
     GEAQSLVCTG FFDDETEKPE DYTDMLLDFK ARDVPMICAN PDLIVERGHR IIPCAGAIAA       180
     YYEQLGGSTR IAGKPHRPIY EATLAAAREL RGDFPVDRVL AIGDGMPTDV RGALNYGLDL       240
     LYISGGIHAK EYTLNGETDE AILNAYLERE NAAPKWWMPR LA                          282
//

If you have problems or comments...

PBIL Back to PBIL home page