(data stored in ACNUC7421 zone)

EMBL: CP001622.PE457

CP001622.PE457       Location/Qualifiers
FT   CDS             478291..478515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0462"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smd:Smed_6262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54769"
FT                   /db_xref="GOA:C6B2E9"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2E9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54769.1"
FT                   /translation="MHVARLLVLTPLFALIVTPAYAYLDPGTGSIIIQSVIGAFAVGAA
FT                   SISLFWQRVKSFLCRTGDNQRQKSGRERK"
     MHVARLLVLT PLFALIVTPA YAYLDPGTGS IIIQSVIGAF AVGAASISLF WQRVKSFLCR        60
     TGDNQRQKSG RERK                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page