(data stored in ACNUC7421 zone)

EMBL: CP001622.PE458

CP001622.PE458       Location/Qualifiers
FT   CDS             478512..479879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0463"
FT                   /product="NoeA host specific nodulation protein"
FT                   /note="KEGG: smd:Smed_6261 NoeA host specific nodulation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54770"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F0"
FT                   /inference="similar to AA sequence:KEGG:Smed_6261"
FT                   /protein_id="ACS54770.1"
FT                   /translation="MMLSRVSGSFRDPSGHVYEGTEHIYRTVESSAAADYEAARNAGIF
FT                   ESPMIVSTTESTAPSPSKTASYLLEHPRIPLISYPYEWSFSMLKDAALLHLDFHLHLLG
FT                   RGFTLSDATAYNVQFLGPTPVFIDHLSVRRYRDGEYWEGHRQFCEQFLVPLLLRSFFGI
FT                   SHNAWYRGALEGISIADFVKMLRFRQKVSWRVLAHLVLQDKFQRSASAGQAEKAQHRQL
FT                   PRNAYTATLQQLRNWIAGLSPRDTDPTTWANYATANTYSNTEATLKKQFVGDFIRRSGA
FT                   TTVIDLGCNTGDYSEVALHNGAQRVFGFDFDQQALDSAYHRAKNKSLNLLPLFLDARNQ
FT                   SPSQGWLQEERTGFASRAKADAALALAFEHHLAIAHNIPLEQVVDWLISVAPTGVVEFV
FT                   PKDDPTVRTMLALRRDIFPDYNYDHFISLIGRRARVLENLVVSSTGRTLISYSRNG"
     MMLSRVSGSF RDPSGHVYEG TEHIYRTVES SAAADYEAAR NAGIFESPMI VSTTESTAPS        60
     PSKTASYLLE HPRIPLISYP YEWSFSMLKD AALLHLDFHL HLLGRGFTLS DATAYNVQFL       120
     GPTPVFIDHL SVRRYRDGEY WEGHRQFCEQ FLVPLLLRSF FGISHNAWYR GALEGISIAD       180
     FVKMLRFRQK VSWRVLAHLV LQDKFQRSAS AGQAEKAQHR QLPRNAYTAT LQQLRNWIAG       240
     LSPRDTDPTT WANYATANTY SNTEATLKKQ FVGDFIRRSG ATTVIDLGCN TGDYSEVALH       300
     NGAQRVFGFD FDQQALDSAY HRAKNKSLNL LPLFLDARNQ SPSQGWLQEE RTGFASRAKA       360
     DAALALAFEH HLAIAHNIPL EQVVDWLISV APTGVVEFVP KDDPTVRTML ALRRDIFPDY       420
     NYDHFISLIG RRARVLENLV VSSTGRTLIS YSRNG                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page