(data stored in ACNUC7421 zone)

EMBL: CP001622.PE459

CP001622.PE459       Location/Qualifiers
FT   CDS             479876..481909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0464"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54771"
FT                   /db_xref="GOA:C6B2F1"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F1"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACS54771.1"
FT                   /translation="MTNLAGHTGSWRGHALASALLAVTLFTVALDVYSRNISEFAGSSI
FT                   LQLLPPVLISIVVGCVAFVITGITGFKPVGMSVVLGAATCVIAASQGVTTSVIPPIDGG
FT                   THPYIVSSGRGVVEFILLFVIFLLTAGFAILRLREALMILSGLTFLALLIPIYNLAARD
FT                   RISTSLGPLMTLSRDVNVIHIMFDSLQSDAFKQIAEQQPDLLSEFDGFAYYPDHAGYAN
FT                   WTTLSIAAIQTGRLFFDQHQDGMDPIEEIGEWLRSSSMMSHLADKGWDVSAVQPSNAFC
FT                   FRTKYYCSTLPFLSNSIGQRLGKQRKSNPLIVVDLALLRLAPTLLKPLVYNEGKLLWSD
FT                   ATGPANADSSTANDIALSMDFAKILTEDIAVTDDNPVYKFLHFYPPHKPFILDEDCRIG
FT                   VARTEDWPNYLPQATCAVKQMAGILRALKRLGAYDNSVIIFQSDTGLGMVRPTENADPK
FT                   ITSVVEYSSPQLVGYARPTLLIKPLGATGPLRVSSVQTSHLNTFSLINDATAGRTNLPN
FT                   VTAPKDRSFVVSRIIRAGTTSVSPYEQFIIVGNVADSAAWQYGGMLSRPGVPYLARPIQ
FT                   SATFSIDADEPLNPNQSIRLVGSVSGGNDVEYTFLRRIKDDKLEIIKDWSPDNTATWEV
FT                   DENGKTPCVANILMAARNRVMGPSEHQINVEKVAKISTSACH"
     MTNLAGHTGS WRGHALASAL LAVTLFTVAL DVYSRNISEF AGSSILQLLP PVLISIVVGC        60
     VAFVITGITG FKPVGMSVVL GAATCVIAAS QGVTTSVIPP IDGGTHPYIV SSGRGVVEFI       120
     LLFVIFLLTA GFAILRLREA LMILSGLTFL ALLIPIYNLA ARDRISTSLG PLMTLSRDVN       180
     VIHIMFDSLQ SDAFKQIAEQ QPDLLSEFDG FAYYPDHAGY ANWTTLSIAA IQTGRLFFDQ       240
     HQDGMDPIEE IGEWLRSSSM MSHLADKGWD VSAVQPSNAF CFRTKYYCST LPFLSNSIGQ       300
     RLGKQRKSNP LIVVDLALLR LAPTLLKPLV YNEGKLLWSD ATGPANADSS TANDIALSMD       360
     FAKILTEDIA VTDDNPVYKF LHFYPPHKPF ILDEDCRIGV ARTEDWPNYL PQATCAVKQM       420
     AGILRALKRL GAYDNSVIIF QSDTGLGMVR PTENADPKIT SVVEYSSPQL VGYARPTLLI       480
     KPLGATGPLR VSSVQTSHLN TFSLINDATA GRTNLPNVTA PKDRSFVVSR IIRAGTTSVS       540
     PYEQFIIVGN VADSAAWQYG GMLSRPGVPY LARPIQSATF SIDADEPLNP NQSIRLVGSV       600
     SGGNDVEYTF LRRIKDDKLE IIKDWSPDNT ATWEVDENGK TPCVANILMA ARNRVMGPSE       660
     HQINVEKVAK ISTSACH                                                      677
//

If you have problems or comments...

PBIL Back to PBIL home page