(data stored in ACNUC7421 zone)

EMBL: CP001622.PE46

CP001622.PE46        Location/Qualifiers
FT   CDS             complement(43656..46382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0047"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="KEGG: ret:RHE_CH00388 DNA mismatch repair protein;
FT                   TIGRFAM: DNA mismatch repair protein MutS; PFAM: DNA
FT                   mismatch repair protein MutS domain protein; MutS II domain
FT                   protein; MutS IV domain protein; MutS III domain protein;
FT                   SMART: DNA mismatch repair protein MutS domain protein;
FT                   MutS III domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54358"
FT                   /db_xref="GOA:C6AYD4"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD4"
FT                   /inference="protein motif:TFAM:TIGR01070"
FT                   /protein_id="ACS54358.1"
FT                   /translation="MNARIDTGNEAFSAAELATAESRASATPMMEQFIEIKANNPGSLL
FT                   FYRMGDFYELFFEDALEASRALGITLTKRGQHMGQDIPMCGVPVHAADDYLQKLISLGF
FT                   RVAVCEQIEDPAEAKKRGAKSVVKRDVVRLVTPGTITEEKLLSPSESNYLMALTRIRAS
FT                   GEALLALAWIDISTGVFRLAETEASRLLADILRIDPRELILPDTIFHDPELKPVFDVLG
FT                   RTAVPQPSVLFDSASAEGRIARYFGVATLDGFGTFSRAELAAAAAAVAYVEKTQIAERP
FT                   PLGKPERESAASTLFIDPATRANLELARTLSGDRNGSLLKAIDRTVTGGGARLLAERLM
FT                   SPLTDPARINARLDSIGFLIDEPLLCGNLRDTLKHVPDMPRALSRLALDRGGPRDLWAI
FT                   RQGLEAAGGIAAMLGKAMLPEELGQALSGLQALPAAVEKLLAETLADELPLLKRDGGFL
FT                   RDGASAELDEVRALRDQSRRVIAGLQLQYAEETGIRSLKIKHNNVLGYFIEVTAGNASP
FT                   MTETAEAKARFIHRQTMANAMRFTTTELADLESRIANAADQALTIELEAFDRMTAAVVA
FT                   EAEAIKSGARALAVIDVAAGLALLAEEQAYCRPQVDGSKMFAIEGGRHPVVEQALRRQA
FT                   GGPFVANHCDLSPRTGDRDGAIWLLTGPNMGGKSTFLRQNALISILAQMGSFVPATSAH
FT                   IGIVDRLFSRVGASDDLARGRSTFMVEMVETAAILNQASDRSLVILDEIGRGTATFDGL
FT                   SIAWAAVEHLHEANRCRGLFATHFHELTVLSEKLGRLSNATMRVKEWDGDVIFLHEVGP
FT                   GAADRSYGIQVARLAGLPASVVARARDVLTRLEDADRKNPASQLIDDLPLFQVAVRREE
FT                   TARGTSKVEEALKAMSLDDMTPREAMDALYDLKKKLK"
     MNARIDTGNE AFSAAELATA ESRASATPMM EQFIEIKANN PGSLLFYRMG DFYELFFEDA        60
     LEASRALGIT LTKRGQHMGQ DIPMCGVPVH AADDYLQKLI SLGFRVAVCE QIEDPAEAKK       120
     RGAKSVVKRD VVRLVTPGTI TEEKLLSPSE SNYLMALTRI RASGEALLAL AWIDISTGVF       180
     RLAETEASRL LADILRIDPR ELILPDTIFH DPELKPVFDV LGRTAVPQPS VLFDSASAEG       240
     RIARYFGVAT LDGFGTFSRA ELAAAAAAVA YVEKTQIAER PPLGKPERES AASTLFIDPA       300
     TRANLELART LSGDRNGSLL KAIDRTVTGG GARLLAERLM SPLTDPARIN ARLDSIGFLI       360
     DEPLLCGNLR DTLKHVPDMP RALSRLALDR GGPRDLWAIR QGLEAAGGIA AMLGKAMLPE       420
     ELGQALSGLQ ALPAAVEKLL AETLADELPL LKRDGGFLRD GASAELDEVR ALRDQSRRVI       480
     AGLQLQYAEE TGIRSLKIKH NNVLGYFIEV TAGNASPMTE TAEAKARFIH RQTMANAMRF       540
     TTTELADLES RIANAADQAL TIELEAFDRM TAAVVAEAEA IKSGARALAV IDVAAGLALL       600
     AEEQAYCRPQ VDGSKMFAIE GGRHPVVEQA LRRQAGGPFV ANHCDLSPRT GDRDGAIWLL       660
     TGPNMGGKST FLRQNALISI LAQMGSFVPA TSAHIGIVDR LFSRVGASDD LARGRSTFMV       720
     EMVETAAILN QASDRSLVIL DEIGRGTATF DGLSIAWAAV EHLHEANRCR GLFATHFHEL       780
     TVLSEKLGRL SNATMRVKEW DGDVIFLHEV GPGAADRSYG IQVARLAGLP ASVVARARDV       840
     LTRLEDADRK NPASQLIDDL PLFQVAVRRE ETARGTSKVE EALKAMSLDD MTPREAMDAL       900
     YDLKKKLK                                                                908
//

If you have problems or comments...

PBIL Back to PBIL home page