(data stored in ACNUC7421 zone)

EMBL: CP001622.PE461

CP001622.PE461       Location/Qualifiers
FT   CDS             483756..488366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0467"
FT                   /product="Ti-type conjugative transfer relaxase TraA"
FT                   /note="TIGRFAM: Ti-type conjugative transfer relaxase TraA;
FT                   PFAM: MobA/MobL protein; KEGG: rec:RHECIAT_PC0000882
FT                   conjugal transfer protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54773"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="InterPro:IPR014136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041533"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F3"
FT                   /inference="protein motif:TFAM:TIGR02768"
FT                   /protein_id="ACS54773.1"
FT                   /translation="MAIMFVKARVISRGAGRRIVPAAAYRHRARMMDEQAGTSFSYRGG
FT                   RAELVHEELALPTQVPEWLRTAIDCRTVAAASEALWNAVEAFEKRPDAQLARELIIALP
FT                   EELTQAENIALVREFVHDNLTSRGMVADWVYHDKDDNPHIHLMMTLRPLKEEGFGAKTV
FT                   QVLDEGGKPLRVVTLDRPKGRIVSKAWAGDKETMKGWKIAWADTANRHLAFAGHEIRLD
FT                   GRSYAEQGLDGIAQRHLGPEKAAHSRRGRQPYYASAGLARRQGVVDRLLSEPEFLLKRL
FT                   GNERSTFDERDIAKALHRYVDDPSDFANIRARLMASDDLVMLKPQEVDPETGNASEPAV
FT                   FTTREILRIEYDMARSAQVLSEHKGFAVPSRYIAAAVKSVEAGDLDKPFKLDAEQINAI
FT                   SHITGDSGIAAVVGLAGAGKSTLLAAARVAWEGEGRRVIGAALAGKAAEGLEDSSGIRS
FT                   RTLAAWELIWANGHETLRRGDVLVVDEAGMVSSQQMARVLKIAEDAGTKVVLVGDAMQL
FT                   QPIQAGAAFRAITERIGFAELAGVRRQRQQWAREASRLFARGEIEKGLDVYAQQGHLIE
FT                   AGTRDEVIGRIVGDWSEARRQAIETSVLKVNGGRLRGDELLVLAHTNQDVKRLNEALRS
FT                   VISDAGALGENRSFRTERGAREFAAGDRIIFLENARFLEPRAPRLGPQYVKNGMLGTVV
FT                   STGDKRGDTLLSVRLDNGRDVVISEDSYRNVDHGYAATIHKSQGATVERTFVLATGMMD
FT                   QHLTYVSMTRHRGRADLYAAKEDFEAKPEWGRKQRADHAAGVTGELVESGQAKFRPNDE
FT                   DADDSPYADVRTDDGTVHRLWGVSLPKALEEGGVSEGDSVTLRKDGVEKVKVQVPVVDE
FT                   QTGQKRYEEREVDRNVWTAKRIETAEARLERIEQESHRPHVFKQLVLRLSRSGAKTTTL
FT                   DFESEASYQAHADDFARRRGIDTLSQTAAGMEEGVSRRLAWIAEKREQVAELWERASVA
FT                   LGFAIERERRVSYNEARIETQTVSDADAGGVRYLIAPTTEFARSAEEDARLAQLSSLAW
FT                   KEREAILRPLLEKIYRDPDAALVALNAMASDVKIEPRRLADDLAAAPDRLGRLRGSDLI
FT                   VDGRAARDERSIATAALTELIPLARAHATEFRRNAERFGVREQQRRAHMSLPIPALSRQ
FT                   VMARLVEIEAVRERGGDDAYKTAFALATEDRSLVQEVKAISEALTERFGWSAFTSKADA
FT                   VAERNMVERMPEDLTGMRGEKLTRPFEAVKHFADEQHLVERRDRSKIVAGANADPEREN
FT                   VPMLAAVTEFKTPIDEEARSRALATPLYRQQRVALAAVASAIWRDPAGAVGKIEELLQK
FT                   GFAAERIAAAVTNDPAAYGALRGSNRLMDRMLASGRERKAAVQATPEVAARLRSLGSAY
FT                   VNVLNAERQAIAEERRRMAVAIPGLSKAAEEVLTRLAAESKSNARKLNASAFFLDPNIR
FT                   QEFAAVSRALDERFGRDAILRQAKDRINRVPPPHRTAFEAMQDRLKILQQAVRIESSDR
FT                   IISERRQRTANRGVDL"
     MAIMFVKARV ISRGAGRRIV PAAAYRHRAR MMDEQAGTSF SYRGGRAELV HEELALPTQV        60
     PEWLRTAIDC RTVAAASEAL WNAVEAFEKR PDAQLARELI IALPEELTQA ENIALVREFV       120
     HDNLTSRGMV ADWVYHDKDD NPHIHLMMTL RPLKEEGFGA KTVQVLDEGG KPLRVVTLDR       180
     PKGRIVSKAW AGDKETMKGW KIAWADTANR HLAFAGHEIR LDGRSYAEQG LDGIAQRHLG       240
     PEKAAHSRRG RQPYYASAGL ARRQGVVDRL LSEPEFLLKR LGNERSTFDE RDIAKALHRY       300
     VDDPSDFANI RARLMASDDL VMLKPQEVDP ETGNASEPAV FTTREILRIE YDMARSAQVL       360
     SEHKGFAVPS RYIAAAVKSV EAGDLDKPFK LDAEQINAIS HITGDSGIAA VVGLAGAGKS       420
     TLLAAARVAW EGEGRRVIGA ALAGKAAEGL EDSSGIRSRT LAAWELIWAN GHETLRRGDV       480
     LVVDEAGMVS SQQMARVLKI AEDAGTKVVL VGDAMQLQPI QAGAAFRAIT ERIGFAELAG       540
     VRRQRQQWAR EASRLFARGE IEKGLDVYAQ QGHLIEAGTR DEVIGRIVGD WSEARRQAIE       600
     TSVLKVNGGR LRGDELLVLA HTNQDVKRLN EALRSVISDA GALGENRSFR TERGAREFAA       660
     GDRIIFLENA RFLEPRAPRL GPQYVKNGML GTVVSTGDKR GDTLLSVRLD NGRDVVISED       720
     SYRNVDHGYA ATIHKSQGAT VERTFVLATG MMDQHLTYVS MTRHRGRADL YAAKEDFEAK       780
     PEWGRKQRAD HAAGVTGELV ESGQAKFRPN DEDADDSPYA DVRTDDGTVH RLWGVSLPKA       840
     LEEGGVSEGD SVTLRKDGVE KVKVQVPVVD EQTGQKRYEE REVDRNVWTA KRIETAEARL       900
     ERIEQESHRP HVFKQLVLRL SRSGAKTTTL DFESEASYQA HADDFARRRG IDTLSQTAAG       960
     MEEGVSRRLA WIAEKREQVA ELWERASVAL GFAIERERRV SYNEARIETQ TVSDADAGGV      1020
     RYLIAPTTEF ARSAEEDARL AQLSSLAWKE REAILRPLLE KIYRDPDAAL VALNAMASDV      1080
     KIEPRRLADD LAAAPDRLGR LRGSDLIVDG RAARDERSIA TAALTELIPL ARAHATEFRR      1140
     NAERFGVREQ QRRAHMSLPI PALSRQVMAR LVEIEAVRER GGDDAYKTAF ALATEDRSLV      1200
     QEVKAISEAL TERFGWSAFT SKADAVAERN MVERMPEDLT GMRGEKLTRP FEAVKHFADE      1260
     QHLVERRDRS KIVAGANADP ERENVPMLAA VTEFKTPIDE EARSRALATP LYRQQRVALA      1320
     AVASAIWRDP AGAVGKIEEL LQKGFAAERI AAAVTNDPAA YGALRGSNRL MDRMLASGRE      1380
     RKAAVQATPE VAARLRSLGS AYVNVLNAER QAIAEERRRM AVAIPGLSKA AEEVLTRLAA      1440
     ESKSNARKLN ASAFFLDPNI RQEFAAVSRA LDERFGRDAI LRQAKDRINR VPPPHRTAFE      1500
     AMQDRLKILQ QAVRIESSDR IISERRQRTA NRGVDL                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page