(data stored in ACNUC7421 zone)

EMBL: CP001622.PE462

CP001622.PE462       Location/Qualifiers
FT   CDS             complement(488419..489333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0468"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   SMART: HEPN domain protein; KEGG: sme:SMa0967 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54774"
FT                   /db_xref="GOA:C6B2F4"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F4"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ACS54774.1"
FT                   /translation="MKSNLDHLPERKQRELARVVDILHEEFQDALKDSSAEFKKMGRIL
FT                   KVILFGSYARGDWVDEPHTLKGYRSDYDLLVIVNNRKLSDFATYWYKAADRFLHDPGIK
FT                   TPVSLIVHSRREVNTALHEGQYFFSDIRREGIVLYELDDEPLPEPKPRSKAEEYLIAKE
FT                   HFEERFPFSTDLLDGFTLYVERRRYKHAAFFLHQVIEHAYSAALLTLSNYSPASHNLTF
FT                   LRKLAEGRDRRLVDAWPRDQQRYRAWFNTINEAYVKARYSNHYEVSEEALIWLGEQTAE
FT                   LHVLVKIVCKEHLTRLRTDATDY"
     MKSNLDHLPE RKQRELARVV DILHEEFQDA LKDSSAEFKK MGRILKVILF GSYARGDWVD        60
     EPHTLKGYRS DYDLLVIVNN RKLSDFATYW YKAADRFLHD PGIKTPVSLI VHSRREVNTA       120
     LHEGQYFFSD IRREGIVLYE LDDEPLPEPK PRSKAEEYLI AKEHFEERFP FSTDLLDGFT       180
     LYVERRRYKH AAFFLHQVIE HAYSAALLTL SNYSPASHNL TFLRKLAEGR DRRLVDAWPR       240
     DQQRYRAWFN TINEAYVKAR YSNHYEVSEE ALIWLGEQTA ELHVLVKIVC KEHLTRLRTD       300
     ATDY                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page