(data stored in ACNUC7421 zone)

EMBL: CP001622.PE465

CP001622.PE465       Location/Qualifiers
FT   CDS             491357..491530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54777"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54777.1"
FT                   /translation="MAGNPATVLIPLRMSLPAVPDSLRARWKMQPAIRPASASVAVVAA
FT                   MVLCRMVHLNLI"
     MAGNPATVLI PLRMSLPAVP DSLRARWKMQ PAIRPASASV AVVAAMVLCR MVHLNLI           57
//

If you have problems or comments...

PBIL Back to PBIL home page