(data stored in ACNUC7421 zone)

EMBL: CP001622.PE466

CP001622.PE466       Location/Qualifiers
FT   CDS             491527..492828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0472"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: ret:RHE_CH00788
FT                   exopolyphosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54778"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F8"
FT                   /inference="protein motif:PFAM:PF02541"
FT                   /protein_id="ACS54778.1"
FT                   /translation="MMEQAGAADHAARSDGDSAPSRRNRRKHRGKRGLQGRPLTPAKPS
FT                   GAPQQERRAEETALGGELRETLNGASANRRGRQESHAHPGHQGDRQAGEHVWPEELYAA
FT                   LDLGTNNCRLLIAQPTRPGQFRVVDAFSRIVRLGEGLAASGRLSDEAMERAIEALRICA
FT                   SKLRNREIRRMRLIATEACRQAVNGEEFLSRVVAETGLALEIIDRETEARLAVSGCSSL
FT                   VGRETRSVVLFDIGGGSSEIAVIRIGDNRFSRLANHITHWTSLPVGVVTLSERHGGHDV
FT                   TPEAFEGMVREVEGMLGSFDCPEIEVAQTGDFHLIGTSGTVTTLAGVHLDLPRYDRRKV
FT                   DGIWLSDDEVSAMQAKLLSWDFASRAANPCIGPDRADLVLAGCAILEAIRRRWPSPRMR
FT                   VADRGLREGLLTDMMADDGVWRRNRNRRGQRVRS"
     MMEQAGAADH AARSDGDSAP SRRNRRKHRG KRGLQGRPLT PAKPSGAPQQ ERRAEETALG        60
     GELRETLNGA SANRRGRQES HAHPGHQGDR QAGEHVWPEE LYAALDLGTN NCRLLIAQPT       120
     RPGQFRVVDA FSRIVRLGEG LAASGRLSDE AMERAIEALR ICASKLRNRE IRRMRLIATE       180
     ACRQAVNGEE FLSRVVAETG LALEIIDRET EARLAVSGCS SLVGRETRSV VLFDIGGGSS       240
     EIAVIRIGDN RFSRLANHIT HWTSLPVGVV TLSERHGGHD VTPEAFEGMV REVEGMLGSF       300
     DCPEIEVAQT GDFHLIGTSG TVTTLAGVHL DLPRYDRRKV DGIWLSDDEV SAMQAKLLSW       360
     DFASRAANPC IGPDRADLVL AGCAILEAIR RRWPSPRMRV ADRGLREGLL TDMMADDGVW       420
     RRNRNRRGQR VRS                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page