(data stored in ACNUC7421 zone)

EMBL: CP001622.PE467

CP001622.PE467       Location/Qualifiers
FT   CDS             492843..493562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0473"
FT                   /product="ribosomal RNA methyltransferase RrmJ/FtsJ"
FT                   /note="PFAM: ribosomal RNA methyltransferase RrmJ/FtsJ;
FT                   KEGG: rec:RHECIAT_CH0000875 ribosomal RNA
FT                   methyltransferase/cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54779"
FT                   /db_xref="GOA:C6B2F9"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2F9"
FT                   /inference="protein motif:PFAM:PF01728"
FT                   /protein_id="ACS54779.1"
FT                   /translation="MTKAPIAGNRTGRKLGQRVKNKKMKASSRQWLERHINDPYVQRAQ
FT                   LEGYRARAAFKLLEIDEKHHILRGARRIIDLGAAPGSWSQIAAKVTGSTDDDIRVAAID
FT                   FLEMTQLPGVKILQLDFLDPTAPEKLLEAVGGTPDLVISDMAAPTTGHHRTDHLRTMHL
FT                   CEVAAHFAVEVLGEGGHFLTKTFQGGTERELLAMLKQNFRQVVHVKPNSSRAESVEMFL
FT                   LAKGFKGRKAEGNAEEA"
     MTKAPIAGNR TGRKLGQRVK NKKMKASSRQ WLERHINDPY VQRAQLEGYR ARAAFKLLEI        60
     DEKHHILRGA RRIIDLGAAP GSWSQIAAKV TGSTDDDIRV AAIDFLEMTQ LPGVKILQLD       120
     FLDPTAPEKL LEAVGGTPDL VISDMAAPTT GHHRTDHLRT MHLCEVAAHF AVEVLGEGGH       180
     FLTKTFQGGT ERELLAMLKQ NFRQVVHVKP NSSRAESVEM FLLAKGFKGR KAEGNAEEA        239
//

If you have problems or comments...

PBIL Back to PBIL home page