(data stored in ACNUC7421 zone)

EMBL: CP001622.PE468

CP001622.PE468       Location/Qualifiers
FT   CDS             493720..494103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0474"
FT                   /product="putative lactoylglutathione lyase protein"
FT                   /note="KEGG: ret:RHE_CH00791 putative lactoylglutathione
FT                   lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54780"
FT                   /db_xref="GOA:C6B2G0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G0"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00791"
FT                   /protein_id="ACS54780.1"
FT                   /translation="MLLYVTLGTNDLYRAGHFYDAVLSPLGYRRQRSSEEEIGYSAEGD
FT                   TRCRFWVVTPFNHRRATSGNGAMVALAAETRADVDAFHAAAIAAGAVDEGEPGLRSYHA
FT                   QFYAAYVRDLDGNKLSAVCENPQ"
     MLLYVTLGTN DLYRAGHFYD AVLSPLGYRR QRSSEEEIGY SAEGDTRCRF WVVTPFNHRR        60
     ATSGNGAMVA LAAETRADVD AFHAAAIAAG AVDEGEPGLR SYHAQFYAAY VRDLDGNKLS       120
     AVCENPQ                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page