(data stored in ACNUC7421 zone)

EMBL: CP001622.PE469

CP001622.PE469       Location/Qualifiers
FT   CDS             complement(494189..495613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0475"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ret:RHE_CH00792 efflux transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54781"
FT                   /db_xref="GOA:C6B2G1"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS54781.1"
FT                   /translation="MNRIVPLILAVALFMEQMDSTVIATALPAIAADLNVGPITLKLAL
FT                   TSYMVALAVFIPVSGWMADRFGAKKIFRLAISVFVIGSIFCAISSNLVEFVFARFLQGM
FT                   GGAMMTPVGRLVLVRTTQRSDLVSAMALLTIPALVGPLTGPPLGGFITTYFSWHWIFLI
FT                   NVPVGIIGISLATIFLPEVEATAPPRLDFTGFVLTSLSAAGVVFGLSVVSLPALPPIIG
FT                   VTATLIGLICGVLYVRHAKRHPAPILNLNLFKNPTFRASTLGGMLFRICVGAMPFLTPL
FT                   MLQLGFGLTPFQSGLITFAGAIGAITTKFMAKRVFAAAGFRTTLLGAAMVTTLVTVVTG
FT                   LFTPSTPHLVIIGVLLLGGFSRSFMFTGVNALAFADIDDAEASQATSMSSVMQQVSLAL
FT                   GVAVAAAILESSIYFRGEALQVADFHLAFYIIAGLTVIATIPFIRMDRNAGALVSGHRL
FT                   KTMTAATVEAEQHAVK"
     MNRIVPLILA VALFMEQMDS TVIATALPAI AADLNVGPIT LKLALTSYMV ALAVFIPVSG        60
     WMADRFGAKK IFRLAISVFV IGSIFCAISS NLVEFVFARF LQGMGGAMMT PVGRLVLVRT       120
     TQRSDLVSAM ALLTIPALVG PLTGPPLGGF ITTYFSWHWI FLINVPVGII GISLATIFLP       180
     EVEATAPPRL DFTGFVLTSL SAAGVVFGLS VVSLPALPPI IGVTATLIGL ICGVLYVRHA       240
     KRHPAPILNL NLFKNPTFRA STLGGMLFRI CVGAMPFLTP LMLQLGFGLT PFQSGLITFA       300
     GAIGAITTKF MAKRVFAAAG FRTTLLGAAM VTTLVTVVTG LFTPSTPHLV IIGVLLLGGF       360
     SRSFMFTGVN ALAFADIDDA EASQATSMSS VMQQVSLALG VAVAAAILES SIYFRGEALQ       420
     VADFHLAFYI IAGLTVIATI PFIRMDRNAG ALVSGHRLKT MTAATVEAEQ HAVK             474
//

If you have problems or comments...

PBIL Back to PBIL home page