(data stored in ACNUC7421 zone)

EMBL: CP001622.PE47

CP001622.PE47        Location/Qualifiers
FT   CDS             46496..48781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0048"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))., Phosphate
FT                   acetyltransferase"
FT                   /EC_number="1.1.1.40"
FT                   /EC_number="2.3.1.8"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; malic
FT                   protein NAD-binding; malic protein domain protein; KEGG:
FT                   rec:RHECIAT_CH0000430 malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+)) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54359"
FT                   /db_xref="GOA:C6AYD5"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD5"
FT                   /inference="protein motif:PRIAM:1.1.1.40"
FT                   /inference="protein motif:PRIAM:2.3.1.8"
FT                   /protein_id="ACS54359.1"
FT                   /translation="MPDIDKKDRPVTSVTDQEALDFHAMGRPGKLEINPTKPMATQRDL
FT                   SLAYSPGVAVPVKAIAADPQTAYDYTARGNMVAVISNGTAILGLGNLGALASKPVMEGK
FT                   AVLFKRFADVDSIDLEIDTENVDEFINCVRFLGPSFGGINLEDIKAPDCFVIESRLREL
FT                   MDIPVFHDDQHGTAIIAAAGLINALELTGRDLKTTKLVCNGAGAAAIACVELIKAMGFA
FT                   PENVILCDTKGVIYQGRTEGMNQWKSAHAAKTDTRTLEEAMKGADVVFGLSQQGAFSAK
FT                   MIRSMAERPIIFAMANPDPEITPEEVARIRDDAIMATGRSDYPNQVNNVLGFPYIFRGA
FT                   LDVRASTINDAMKIAAVNALANLAREDVPDDVVAAYQGNRPRFGSQYIIPVPFDPRLIS
FT                   AIPVAVAQAAIESGVARKVITDMAGYARELSARRDPIASTLASLYERVRRRPKRIVFAE
FT                   AEEEQVLRAAMSYANQQLGTAILLGREDLIRATAERAGIDLNRPGLEIVNARLSTRVEA
FT                   YIDYLYARLQRHGYLHRDAQRLIHNDRNHFAATMVALGDADGMVTGITRNYSTALEDVR
FT                   RCIDEKPGHRVIGVSLALCRGRTVFVADTAVHDMPTAEELADIAEEAAGLARRMGYPPR
FT                   VALLAYSTFGHPSGERSERVREAVKILDKRRVDFEYDGEMAADVALNRKVMEQYPFCRL
FT                   SGPANVLVMPAFHSASISTKMLQELGGSTVIGPILVGLDKPVQITSMGAKDSDIVNMAA
FT                   IAAYGAGS"
     MPDIDKKDRP VTSVTDQEAL DFHAMGRPGK LEINPTKPMA TQRDLSLAYS PGVAVPVKAI        60
     AADPQTAYDY TARGNMVAVI SNGTAILGLG NLGALASKPV MEGKAVLFKR FADVDSIDLE       120
     IDTENVDEFI NCVRFLGPSF GGINLEDIKA PDCFVIESRL RELMDIPVFH DDQHGTAIIA       180
     AAGLINALEL TGRDLKTTKL VCNGAGAAAI ACVELIKAMG FAPENVILCD TKGVIYQGRT       240
     EGMNQWKSAH AAKTDTRTLE EAMKGADVVF GLSQQGAFSA KMIRSMAERP IIFAMANPDP       300
     EITPEEVARI RDDAIMATGR SDYPNQVNNV LGFPYIFRGA LDVRASTIND AMKIAAVNAL       360
     ANLAREDVPD DVVAAYQGNR PRFGSQYIIP VPFDPRLISA IPVAVAQAAI ESGVARKVIT       420
     DMAGYARELS ARRDPIASTL ASLYERVRRR PKRIVFAEAE EEQVLRAAMS YANQQLGTAI       480
     LLGREDLIRA TAERAGIDLN RPGLEIVNAR LSTRVEAYID YLYARLQRHG YLHRDAQRLI       540
     HNDRNHFAAT MVALGDADGM VTGITRNYST ALEDVRRCID EKPGHRVIGV SLALCRGRTV       600
     FVADTAVHDM PTAEELADIA EEAAGLARRM GYPPRVALLA YSTFGHPSGE RSERVREAVK       660
     ILDKRRVDFE YDGEMAADVA LNRKVMEQYP FCRLSGPANV LVMPAFHSAS ISTKMLQELG       720
     GSTVIGPILV GLDKPVQITS MGAKDSDIVN MAAIAAYGAG S                           761
//

If you have problems or comments...

PBIL Back to PBIL home page