(data stored in ACNUC7421 zone)

EMBL: CP001622.PE470

CP001622.PE470       Location/Qualifiers
FT   CDS             495862..496854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0476"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rec:RHECIAT_CH0000878 putative beta-lactamase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54782"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G2"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACS54782.1"
FT                   /translation="MTISSGIKRRTLFAAGLGLLGAPVILREKAEAAATGERNHMDGTL
FT                   LPEINQFKLGSYTFTVVRDGTSIVEKPYETFGTNQDPETVKGLLTANFLPADKFMNGYT
FT                   PALIDTGSDVILVDTGFGAAGRARGAGQLTEGLKAAGYSADDVTLVALTHLHGDHIGGL
FT                   MEDGAAAFKNARYVVGQAEYDFWSDKAREGTPAEGGHKAVLANVVPFAEKTTFIKEGDS
FT                   VAPGVTAVLAAGHSPGHMVFHVESEGKRLVLTGDTANHYILSLLRPDWEVRFDMDKAQA
FT                   AATRRKVFEMIASEKIAFLGYHMPFPAVGFVERQDGGYRFVPKSYQFDI"
     MTISSGIKRR TLFAAGLGLL GAPVILREKA EAAATGERNH MDGTLLPEIN QFKLGSYTFT        60
     VVRDGTSIVE KPYETFGTNQ DPETVKGLLT ANFLPADKFM NGYTPALIDT GSDVILVDTG       120
     FGAAGRARGA GQLTEGLKAA GYSADDVTLV ALTHLHGDHI GGLMEDGAAA FKNARYVVGQ       180
     AEYDFWSDKA REGTPAEGGH KAVLANVVPF AEKTTFIKEG DSVAPGVTAV LAAGHSPGHM       240
     VFHVESEGKR LVLTGDTANH YILSLLRPDW EVRFDMDKAQ AAATRRKVFE MIASEKIAFL       300
     GYHMPFPAVG FVERQDGGYR FVPKSYQFDI                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page