(data stored in ACNUC7421 zone)

EMBL: CP001622.PE471

CP001622.PE471       Location/Qualifiers
FT   CDS             497135..498619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0477"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="KEGG: ret:RHE_CH00794 inositol-5-monophosphate
FT                   dehydrogenase; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase; PFAM: IMP dehydrogenase/GMP reductase; CBS
FT                   domain containing protein; 2-nitropropane dioxygenase NPD;
FT                   SMART: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54783"
FT                   /db_xref="GOA:C6B2G3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G3"
FT                   /inference="protein motif:TFAM:TIGR01302"
FT                   /protein_id="ACS54783.1"
FT                   /translation="MARIIETATGADALTFDDVLLQPGHSEVMPGQTNISTRIARDFEL
FT                   NIPIISSAMDTVTESRLAIAMAQAGGLGVIHRNLTPIEQAEQVRQVKKFESGMVVNPVT
FT                   IGPDETLADALGLMKSYSISGIPVVEKSGRLVGILTNRDVRFATDQEQKIHELMTKDKL
FT                   VTVKENVDQQEAKRLLHSHRIEKLLVVDTEGRCVGLITVKDIEKSQLNPNASKDAQGRL
FT                   RAAAAISVGDDGFERAERLIEAGVDLLVVDTAHGHSQRVLDAVSRVKKLSNSVRIMAGN
FT                   VATYDGTRALIDAGADAVKVGIGPGSICTTRIVAGVGVPQLAAIMSAVQAANDQDVPVI
FT                   ADGGIKFSGDLAKAIAAGASAVMIGSLLAGTDESPGEVYLYQGRSFKAYRGMGSVGAMA
FT                   RGSADRYFQAEVRDTLKLVPEGIEGQVPYKGPVSGVIHQLAGGLKAAMGYVGGKDLKDF
FT                   QERATFVRISGAGLRESHAHDVTITRESPNYPGAGL"
     MARIIETATG ADALTFDDVL LQPGHSEVMP GQTNISTRIA RDFELNIPII SSAMDTVTES        60
     RLAIAMAQAG GLGVIHRNLT PIEQAEQVRQ VKKFESGMVV NPVTIGPDET LADALGLMKS       120
     YSISGIPVVE KSGRLVGILT NRDVRFATDQ EQKIHELMTK DKLVTVKENV DQQEAKRLLH       180
     SHRIEKLLVV DTEGRCVGLI TVKDIEKSQL NPNASKDAQG RLRAAAAISV GDDGFERAER       240
     LIEAGVDLLV VDTAHGHSQR VLDAVSRVKK LSNSVRIMAG NVATYDGTRA LIDAGADAVK       300
     VGIGPGSICT TRIVAGVGVP QLAAIMSAVQ AANDQDVPVI ADGGIKFSGD LAKAIAAGAS       360
     AVMIGSLLAG TDESPGEVYL YQGRSFKAYR GMGSVGAMAR GSADRYFQAE VRDTLKLVPE       420
     GIEGQVPYKG PVSGVIHQLA GGLKAAMGYV GGKDLKDFQE RATFVRISGA GLRESHAHDV       480
     TITRESPNYP GAGL                                                         494
//

If you have problems or comments...

PBIL Back to PBIL home page