(data stored in ACNUC7421 zone)

EMBL: CP001622.PE472

CP001622.PE472       Location/Qualifiers
FT   CDS             498622..499176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00795 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54784"
FT                   /db_xref="GOA:C6B2G4"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G4"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00795"
FT                   /protein_id="ACS54784.1"
FT                   /translation="MKAGSGIPLWIVALLAALCLAVLAWTTFGFVVPFKHETGQAVLDT
FT                   YFAGYDESAVFHMQKLLDENETATRLLRAMYFGPELIFPALLTALLFLAFLKLGPGGAW
FT                   FGRSAHPLVGKAIYLLPFIYGIADYGENISSLIAFGNGASAGLATQLLPWMTRLKFASL
FT                   AICFILIARLAVMRWLSSRPD"
     MKAGSGIPLW IVALLAALCL AVLAWTTFGF VVPFKHETGQ AVLDTYFAGY DESAVFHMQK        60
     LLDENETATR LLRAMYFGPE LIFPALLTAL LFLAFLKLGP GGAWFGRSAH PLVGKAIYLL       120
     PFIYGIADYG ENISSLIAFG NGASAGLATQ LLPWMTRLKF ASLAICFILI ARLAVMRWLS       180
     SRPD                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page