(data stored in ACNUC7421 zone)

EMBL: CP001622.PE473

CP001622.PE473       Location/Qualifiers
FT   CDS             499341..499757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0479"
FT                   /product="protein of unknown function DUF1123"
FT                   /note="PFAM: protein of unknown function DUF1123; KEGG:
FT                   rec:RHECIAT_CH0000883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54785"
FT                   /db_xref="GOA:C6B2G5"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G5"
FT                   /inference="protein motif:PFAM:PF06561"
FT                   /protein_id="ACS54785.1"
FT                   /translation="MTGYQIFWPLLAHVALVYGLYALLGLRRAKMVRAGSIVKSDYREN
FT                   RGEPAESLVVKNCLANQFELPVLFYACCILLYITEADNLVALGLAWAFVALRYAHAAIH
FT                   VTSNDLRYRSPIFAAGYLVLAAMWIWLAAWMLMS"
     MTGYQIFWPL LAHVALVYGL YALLGLRRAK MVRAGSIVKS DYRENRGEPA ESLVVKNCLA        60
     NQFELPVLFY ACCILLYITE ADNLVALGLA WAFVALRYAH AAIHVTSNDL RYRSPIFAAG       120
     YLVLAAMWIW LAAWMLMS                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page