(data stored in ACNUC7421 zone)

EMBL: CP001622.PE474

CP001622.PE474       Location/Qualifiers
FT   CDS             500049..503138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0480"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain protein; autotransporter-associated beta strand
FT                   repeat protein; PFAM: Autotransporter beta- domain protein;
FT                   KEGG: bpa:BPP0822 autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54786"
FT                   /db_xref="GOA:C6B2G6"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR030895"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G6"
FT                   /inference="protein motif:TFAM:TIGR01414"
FT                   /protein_id="ACS54786.1"
FT                   /translation="MGERISGAAIQGMVMLRLTGLASTAALVLAVGPGWAQVITGNDTE
FT                   IVDGNDPGGTGAGTQPSPWTINTNLIVGDQNGDDAALVIRNGGIVSNDIGVLGVDPGAA
FT                   GTVTVTGTGSAWTNSDDLYVGHRGVGVLNIEDGGVVDNIFGRIGYFSGASGTVTVTGTG
FT                   STWTNAQDLYIGDSGTGTLTISNGGTVSSTAGLISNDTTAIGEVIVTGTNSIWSNSSYI
FT                   SVGEAGAGTLTISNGGSVTASEGYVGYSSNGNGVVSVTDTGSSWINSGALFVGEFGSGS
FT                   MSVENGGTVSASEVIIADDSGATGTVRIAGSAANGRGVLETGYIERGGGDADLVFDGGI
FT                   LSATGNEANFLRGFNAGEVTIDAGGAFIDTNGFAVGIATDLQGAGGLTKKGSGTLTLSG
FT                   TSSFTGVTTVEAGTLQAGSAGAFVQNGAYAVNGGIFDLGGFDLTMAQLSGSGGEIVIGS
FT                   AELTLDQANNTTYGGILSGSGDFTMLGSGTLRLTGNSSGFAGTTTVSDGRLIVNGSLGG
FT                   ILMMTGGTLAGSGHIGTVTAGAGVTIAPGNSIGTLTIGGNLTLDPSSTYEVEVDPAGTA
FT                   SDLISVTGTAFLNGASVTHVGMNGDYQPFSTYTILTAAGGINGTFGAVTSDYAFLAAEL
FT                   SYDLNNVYLEIERNNVRFSDMARTRNQMAAAEAAENLGTGNDIYDAIVTLPDDEPLIQA
FT                   SYDALSGEIHGSIKTALITQSLVVRQAANERLRSAFSDASAGVIPIQAFWPGGPELIAA
FT                   NPSDAPVFWSTAFGGASETRTDGNAATLNHQTGGLLAGVDAMFDDVRLGLMAGYSNSQF
FT                   DPRHRSSSGSSDDYHLGLYAGTQWGGLAFRTGLAHTWHEIETNRSVAIGSFEDRLEASY
FT                   NAGTLQAFAELGYRFDTAAATFEPFVNLAHIGIRTAGFTEGGGAAALDSSSRMTNTTIT
FT                   TLGLHAEMEVRLGETNATLRGMSGWRHAAGDIVPVSTHAFAGGDAFTVAGVPVAENAFV
FT                   LDAGLDFDLTESAILGIAYSGQIADNAQQHGAKATLSVKF"
     MGERISGAAI QGMVMLRLTG LASTAALVLA VGPGWAQVIT GNDTEIVDGN DPGGTGAGTQ        60
     PSPWTINTNL IVGDQNGDDA ALVIRNGGIV SNDIGVLGVD PGAAGTVTVT GTGSAWTNSD       120
     DLYVGHRGVG VLNIEDGGVV DNIFGRIGYF SGASGTVTVT GTGSTWTNAQ DLYIGDSGTG       180
     TLTISNGGTV SSTAGLISND TTAIGEVIVT GTNSIWSNSS YISVGEAGAG TLTISNGGSV       240
     TASEGYVGYS SNGNGVVSVT DTGSSWINSG ALFVGEFGSG SMSVENGGTV SASEVIIADD       300
     SGATGTVRIA GSAANGRGVL ETGYIERGGG DADLVFDGGI LSATGNEANF LRGFNAGEVT       360
     IDAGGAFIDT NGFAVGIATD LQGAGGLTKK GSGTLTLSGT SSFTGVTTVE AGTLQAGSAG       420
     AFVQNGAYAV NGGIFDLGGF DLTMAQLSGS GGEIVIGSAE LTLDQANNTT YGGILSGSGD       480
     FTMLGSGTLR LTGNSSGFAG TTTVSDGRLI VNGSLGGILM MTGGTLAGSG HIGTVTAGAG       540
     VTIAPGNSIG TLTIGGNLTL DPSSTYEVEV DPAGTASDLI SVTGTAFLNG ASVTHVGMNG       600
     DYQPFSTYTI LTAAGGINGT FGAVTSDYAF LAAELSYDLN NVYLEIERNN VRFSDMARTR       660
     NQMAAAEAAE NLGTGNDIYD AIVTLPDDEP LIQASYDALS GEIHGSIKTA LITQSLVVRQ       720
     AANERLRSAF SDASAGVIPI QAFWPGGPEL IAANPSDAPV FWSTAFGGAS ETRTDGNAAT       780
     LNHQTGGLLA GVDAMFDDVR LGLMAGYSNS QFDPRHRSSS GSSDDYHLGL YAGTQWGGLA       840
     FRTGLAHTWH EIETNRSVAI GSFEDRLEAS YNAGTLQAFA ELGYRFDTAA ATFEPFVNLA       900
     HIGIRTAGFT EGGGAAALDS SSRMTNTTIT TLGLHAEMEV RLGETNATLR GMSGWRHAAG       960
     DIVPVSTHAF AGGDAFTVAG VPVAENAFVL DAGLDFDLTE SAILGIAYSG QIADNAQQHG      1020
     AKATLSVKF                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page