(data stored in ACNUC7421 zone)

EMBL: CP001622.PE475

CP001622.PE475       Location/Qualifiers
FT   CDS             503275..503994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0481"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   rec:RHECIAT_CH0000884 probable transcriptional regulator
FT                   protein, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54787"
FT                   /db_xref="GOA:C6B2G7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS54787.1"
FT                   /translation="MRVFPFTADEDLHVMPSAANKKNGNDMGAESMDRIGLRRKPKQER
FT                   SIQRLDLILAAAAKIIAEKGVSAMRMTELAAAAKVPIGSVYQYFPEKAAIVKALFDQHA
FT                   SAIQTKMAAMFADVRSLDQALDVVCATIDWYYDSYHDDPVYLGVWMGTETDQDLLQLNI
FT                   EHSGHVAGIFRDAVRQLAPDLCDEEMYARTYLFSHLIGAVIRLAAVSEEALARRMLDEW
FT                   KRVIRASLFTVTVPAAA"
     MRVFPFTADE DLHVMPSAAN KKNGNDMGAE SMDRIGLRRK PKQERSIQRL DLILAAAAKI        60
     IAEKGVSAMR MTELAAAAKV PIGSVYQYFP EKAAIVKALF DQHASAIQTK MAAMFADVRS       120
     LDQALDVVCA TIDWYYDSYH DDPVYLGVWM GTETDQDLLQ LNIEHSGHVA GIFRDAVRQL       180
     APDLCDEEMY ARTYLFSHLI GAVIRLAAVS EEALARRMLD EWKRVIRASL FTVTVPAAA        239
//

If you have problems or comments...

PBIL Back to PBIL home page