(data stored in ACNUC7421 zone)

EMBL: CP001622.PE476

CP001622.PE476       Location/Qualifiers
FT   CDS             complement(504001..504969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0482"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ret:RHE_CH00800 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54788"
FT                   /db_xref="GOA:C6B2G8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G8"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS54788.1"
FT                   /translation="MGDNMSAPLDLDQLQTFIAIVDSGSFTKAADRVYKTQSAVSMQMR
FT                   RLEERIGKQLFIKDGRGNRLTVEGEKLLNYARRIIRLNNEAIAAFDDNRLEGTLRIGTP
FT                   DDYADRYMPEIIGRFAKTHPNVELYIVCEPSVDLAERMHKGELDIALVTHNPRERMSDV
FT                   VRTEPLCWVGSANHPIRDDAPVPLAVGRRDCQWRQLACSALDAVGREHQILFTSWSCTV
FT                   VAAAVLAGMAVSVMPESALRTGMKVLSQADGFPALPPVQIGIMKRPGVSLSLMNAITAH
FT                   ITACLDNITPTVVDDSLEADVKSAQARLYPRLKAANMVPSW"
     MGDNMSAPLD LDQLQTFIAI VDSGSFTKAA DRVYKTQSAV SMQMRRLEER IGKQLFIKDG        60
     RGNRLTVEGE KLLNYARRII RLNNEAIAAF DDNRLEGTLR IGTPDDYADR YMPEIIGRFA       120
     KTHPNVELYI VCEPSVDLAE RMHKGELDIA LVTHNPRERM SDVVRTEPLC WVGSANHPIR       180
     DDAPVPLAVG RRDCQWRQLA CSALDAVGRE HQILFTSWSC TVVAAAVLAG MAVSVMPESA       240
     LRTGMKVLSQ ADGFPALPPV QIGIMKRPGV SLSLMNAITA HITACLDNIT PTVVDDSLEA       300
     DVKSAQARLY PRLKAANMVP SW                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page