(data stored in ACNUC7421 zone)

EMBL: CP001622.PE477

CP001622.PE477       Location/Qualifiers
FT   CDS             505173..505472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0483"
FT                   /product="protein of unknown function DUF1127"
FT                   /note="PFAM: protein of unknown function DUF1127; KEGG:
FT                   ret:RHE_CH00801 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54789"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2G9"
FT                   /inference="protein motif:PFAM:PF06568"
FT                   /protein_id="ACS54789.1"
FT                   /translation="MRMTDRTIELDCGKLTPTFPQRLAAGLAPLTSLFRGFRNRMEINT
FT                   LHDLSDAQLRDIGLNRADLTSAFLASTFFEDPSEHLTRSARNRWRLSLFRSYEQ"
     MRMTDRTIEL DCGKLTPTFP QRLAAGLAPL TSLFRGFRNR MEINTLHDLS DAQLRDIGLN        60
     RADLTSAFLA STFFEDPSEH LTRSARNRWR LSLFRSYEQ                               99
//

If you have problems or comments...

PBIL Back to PBIL home page