(data stored in ACNUC7421 zone)

EMBL: CP001622.PE478

CP001622.PE478       Location/Qualifiers
FT   CDS             complement(505632..506498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000887 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54790"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H0"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000887"
FT                   /protein_id="ACS54790.1"
FT                   /translation="MLPLFDMMMQAQNGAAMEAIARQFNLAQEQATKAMAALMPAFSAG
FT                   LKRSTSNPYDFVGLMQAVSSGNYARYFEDMNRAFTPEGISDGNNILAQLFGSKEVSRAV
FT                   AAQAAQMTGIGQDIYKRMLPVLADTLMGGLFKQTTGQMASPVNPFVNTAMGETMQKWLE
FT                   STGFAPKPKTTPDPSIFDNPFTQAMQLMFSVPKPEATSQPNPFLDNPFAKAFQEMMGGL
FT                   GQQPAAQTKTKTPEAPKEEAKLNADSYTEMLNAMFDSGLEVQKNYQRNLEAIFETYRPK
FT                   PSSDKSE"
     MLPLFDMMMQ AQNGAAMEAI ARQFNLAQEQ ATKAMAALMP AFSAGLKRST SNPYDFVGLM        60
     QAVSSGNYAR YFEDMNRAFT PEGISDGNNI LAQLFGSKEV SRAVAAQAAQ MTGIGQDIYK       120
     RMLPVLADTL MGGLFKQTTG QMASPVNPFV NTAMGETMQK WLESTGFAPK PKTTPDPSIF       180
     DNPFTQAMQL MFSVPKPEAT SQPNPFLDNP FAKAFQEMMG GLGQQPAAQT KTKTPEAPKE       240
     EAKLNADSYT EMLNAMFDSG LEVQKNYQRN LEAIFETYRP KPSSDKSE                    288
//

If you have problems or comments...

PBIL Back to PBIL home page