(data stored in ACNUC7421 zone)

EMBL: CP001622.PE479

CP001622.PE479       Location/Qualifiers
FT   CDS             complement(506844..508217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0485"
FT                   /product="glutamate/cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="KEGG: ret:RHE_CH00803 glutamate-cysteine ligase
FT                   protein; TIGRFAM: glutamate/cysteine ligase; PFAM:
FT                   glutamate--cysteine ligase GCS2"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54791"
FT                   /db_xref="GOA:C6B2H1"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011556"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR035434"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H1"
FT                   /inference="protein motif:TFAM:TIGR01436"
FT                   /protein_id="ACS54791.1"
FT                   /translation="MARDTTDQTPLSSVQDLTDYIAAGNKPREHFRIGTEHEKFAFFRA
FT                   DNSPVPYFGDASISALLTGLQKKSGWEPITDGGNIIGLAEQHGMGAISIEPGGQFELSG
FT                   APLETIHETCKESNQHLATLREIAEPMGIRFLGIGGSPKWTYAETPQMPKSRYEIMTRY
FT                   MPKVGTQGLDMMYRTCTIQVNLDFSSEADMRKKMRVSMKLQSLATALFASSPFTEGKPN
FT                   GLLSWRGDIWRDVDNRRAGLLDFSFRDDFGFRDYAEWALDAPMYFIVREGRYHDCTHVT
FT                   FRQFMNGALKGEVADPAPTMGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAF
FT                   WVGLLYDDAALDAADELTKDWTFAEISALRNAVPAEGLKAQFRGHPLFDMAREVVGISR
FT                   AGLKARGKLNREGQDETIFLAPLDEVLAKKATLAEDLLSLYHGRWHGSVEPVFEDYQY"
     MARDTTDQTP LSSVQDLTDY IAAGNKPREH FRIGTEHEKF AFFRADNSPV PYFGDASISA        60
     LLTGLQKKSG WEPITDGGNI IGLAEQHGMG AISIEPGGQF ELSGAPLETI HETCKESNQH       120
     LATLREIAEP MGIRFLGIGG SPKWTYAETP QMPKSRYEIM TRYMPKVGTQ GLDMMYRTCT       180
     IQVNLDFSSE ADMRKKMRVS MKLQSLATAL FASSPFTEGK PNGLLSWRGD IWRDVDNRRA       240
     GLLDFSFRDD FGFRDYAEWA LDAPMYFIVR EGRYHDCTHV TFRQFMNGAL KGEVADPAPT       300
     MGDWTNHLST LFPDVRLKRF LEMRGADGGP WRRICALPAF WVGLLYDDAA LDAADELTKD       360
     WTFAEISALR NAVPAEGLKA QFRGHPLFDM AREVVGISRA GLKARGKLNR EGQDETIFLA       420
     PLDEVLAKKA TLAEDLLSLY HGRWHGSVEP VFEDYQY                                457
//

If you have problems or comments...

PBIL Back to PBIL home page