(data stored in ACNUC7421 zone)

EMBL: CP001622.PE48

CP001622.PE48        Location/Qualifiers
FT   CDS             49014..50003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0049"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: rec:RHECIAT_CH0000431 putative
FT                   transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54360"
FT                   /db_xref="GOA:C6AYD6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD6"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS54360.1"
FT                   /translation="MPENASANFTPRFQGATFDDMVGALTKGFGSFDAWRDGRDKPLDW
FT                   KVGFWGDESLSLVSNQDSGGWGARTAHGTPETLAIIVPRTGALDVTLGRSVIEGTPGRL
FT                   LLANNLEPERISVRAAPHRSDTLSLSWTIIAQTVASVLETPLIGAMDLAPVIDLSTAAG
FT                   RLIGSLAQTIIIGMRNNGPLLASPIAMLNLTQAFADLLVRSVPHRLSHLLDRKIHLIAP
FT                   RHVRRAIEFMHANIAEPLTMQSVAEAAGISIRALESGFRAFKGTTPAAYLRTIRLQAVR
FT                   EDLRDPSNRQPLRDICLKWGFFHFGRFAATYRAAYGENPSDTRRRSDH"
     MPENASANFT PRFQGATFDD MVGALTKGFG SFDAWRDGRD KPLDWKVGFW GDESLSLVSN        60
     QDSGGWGART AHGTPETLAI IVPRTGALDV TLGRSVIEGT PGRLLLANNL EPERISVRAA       120
     PHRSDTLSLS WTIIAQTVAS VLETPLIGAM DLAPVIDLST AAGRLIGSLA QTIIIGMRNN       180
     GPLLASPIAM LNLTQAFADL LVRSVPHRLS HLLDRKIHLI APRHVRRAIE FMHANIAEPL       240
     TMQSVAEAAG ISIRALESGF RAFKGTTPAA YLRTIRLQAV REDLRDPSNR QPLRDICLKW       300
     GFFHFGRFAA TYRAAYGENP SDTRRRSDH                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page