(data stored in ACNUC7421 zone)

EMBL: CP001622.PE480

CP001622.PE480       Location/Qualifiers
FT   CDS             complement(508365..509102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0486"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   rec:RHECIAT_CH0000889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54792"
FT                   /db_xref="GOA:C6B2H2"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H2"
FT                   /inference="protein motif:PFAM:PF04452"
FT                   /protein_id="ACS54792.1"
FT                   /translation="MRANFRMQRLFVDAPLTRGAGVEANADQFNYLANVLRMEDGGEIL
FT                   LFNGRDGEWKATLTFPTRKRILLTATEETRPQPQPCDLHYLFAPLKVGRMDYLVQKAVE
FT                   MGAGLLQPVMTQHVQGKVTNLDKLRANVIEAAEQCGILGIPDVAEPVRLLDLLDRWPSE
FT                   RRIIYCDEGDAGQNPLPVLSAIRERHLALLVGPEGGFSEEERARLRSLDFVTAIPLGPR
FT                   ILRADTAAVAALAVVQAAIGDWN"
     MRANFRMQRL FVDAPLTRGA GVEANADQFN YLANVLRMED GGEILLFNGR DGEWKATLTF        60
     PTRKRILLTA TEETRPQPQP CDLHYLFAPL KVGRMDYLVQ KAVEMGAGLL QPVMTQHVQG       120
     KVTNLDKLRA NVIEAAEQCG ILGIPDVAEP VRLLDLLDRW PSERRIIYCD EGDAGQNPLP       180
     VLSAIRERHL ALLVGPEGGF SEEERARLRS LDFVTAIPLG PRILRADTAA VAALAVVQAA       240
     IGDWN                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page