(data stored in ACNUC7421 zone)

EMBL: CP001622.PE481

CP001622.PE481       Location/Qualifiers
FT   CDS             complement(509201..510700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0487"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: ret:RHE_CH00805
FT                   phosphate ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54793"
FT                   /db_xref="GOA:C6B2H3"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H3"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ACS54793.1"
FT                   /translation="MPPRPAVLTKRTLDKDLDKITHAEDVAKHVLRRLVAPGLGLIFVG
FT                   LAMLFAGVYVFDRPGAMLVIAAAALAGYMAMNIGANDVTNNVGAAVGARAMTMGQALVI
FT                   AAIFEVLGATIAGGEVVKTISSNIVDAVQVPPALLGWIMMAALMAAALWINLATWMNAP
FT                   VSTTHAIVGAVIGAGISAVGPEPVNWQVMLEITSSWITSPLIGGLIAAGLLYLVKTLII
FT                   YRDDKVAAAQRWVPVLVAVMAGGFMAYMVLQLSPPGRFPPLTVLLIGIGIGLVSWLAAR
FT                   PLVLAQARELENRNSSLRTLFRLPLIGSAALLSFAHGANDVSNAVGPLSAIVHSVGIGG
FT                   GGGIGHPPLWVMLIGALGISVGLLLFGPRLIRLVGEEITKLNPMRAYCVALSTAFTVIV
FT                   ASWLGLPVSTTHIAVGAVFGVGFFREWYTRHSKRRIAYIRRKAESFDIDEPEEPNIHET
FT                   RRRYLVRRSHFMTIVAAWIVTVPVSAALAAMIYWVMFALFV"
     MPPRPAVLTK RTLDKDLDKI THAEDVAKHV LRRLVAPGLG LIFVGLAMLF AGVYVFDRPG        60
     AMLVIAAAAL AGYMAMNIGA NDVTNNVGAA VGARAMTMGQ ALVIAAIFEV LGATIAGGEV       120
     VKTISSNIVD AVQVPPALLG WIMMAALMAA ALWINLATWM NAPVSTTHAI VGAVIGAGIS       180
     AVGPEPVNWQ VMLEITSSWI TSPLIGGLIA AGLLYLVKTL IIYRDDKVAA AQRWVPVLVA       240
     VMAGGFMAYM VLQLSPPGRF PPLTVLLIGI GIGLVSWLAA RPLVLAQARE LENRNSSLRT       300
     LFRLPLIGSA ALLSFAHGAN DVSNAVGPLS AIVHSVGIGG GGGIGHPPLW VMLIGALGIS       360
     VGLLLFGPRL IRLVGEEITK LNPMRAYCVA LSTAFTVIVA SWLGLPVSTT HIAVGAVFGV       420
     GFFREWYTRH SKRRIAYIRR KAESFDIDEP EEPNIHETRR RYLVRRSHFM TIVAAWIVTV       480
     PVSAALAAMI YWVMFALFV                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page