(data stored in ACNUC7421 zone)

EMBL: CP001622.PE482

CP001622.PE482       Location/Qualifiers
FT   CDS             complement(510763..511293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0488"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rec:RHECIAT_CH0000891
FT                   putative NTP pyrophosphohydrolase protein, MuT/NUDIX
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54794"
FT                   /db_xref="GOA:C6B2H4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H4"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACS54794.1"
FT                   /translation="MTLFARLASDVQLMFRRPPRQQYGALCYRVKKKSGEVEVLLMTSR
FT                   DTGRWVIPKGWPMTRKCAHEVAMQEAFEEAGVRGAVETETLGAYTYSKALRDGVQVICK
FT                   VQVYALEVTDMAKNFKEKGERRIEWVSFDEAAARVREPELRHLFLAFKQKMTDRLSAKA
FT                   AKQIPDVKQIPAE"
     MTLFARLASD VQLMFRRPPR QQYGALCYRV KKKSGEVEVL LMTSRDTGRW VIPKGWPMTR        60
     KCAHEVAMQE AFEEAGVRGA VETETLGAYT YSKALRDGVQ VICKVQVYAL EVTDMAKNFK       120
     EKGERRIEWV SFDEAAARVR EPELRHLFLA FKQKMTDRLS AKAAKQIPDV KQIPAE           176
//

If you have problems or comments...

PBIL Back to PBIL home page