(data stored in ACNUC7421 zone)

EMBL: CP001622.PE483

CP001622.PE483       Location/Qualifiers
FT   CDS             511527..512435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0489"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54795"
FT                   /db_xref="GOA:C6B2H5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H5"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS54795.1"
FT                   /translation="MIHHDFVNVVPMRLPPLNAIRAFEAVCRHGSILKAAEELNVVRAA
FT                   VRQQIDTLENHFGSKLFLRDGRRLVPTLQASAFAAAASAAFDILQRAASELEGAVPRRI
FT                   RLGVPSAFAVWWLMPRAADMQASLGDTVDIVPMATVEPLQMHLELDAVIMGGEYRPAAG
FT                   ITALRFMADEFGPVATPSLGATLSSDPAAMGTQTMLISRSVPKLWDEWFAESGTPPVVF
FT                   SRTQEFADLLLALGAARSGLGIALAPRASIEDDLERGHLVAPYGFISRPSGYNFCCRTP
FT                   DVKRPAFAALSGWLLRCGTPA"
     MIHHDFVNVV PMRLPPLNAI RAFEAVCRHG SILKAAEELN VVRAAVRQQI DTLENHFGSK        60
     LFLRDGRRLV PTLQASAFAA AASAAFDILQ RAASELEGAV PRRIRLGVPS AFAVWWLMPR       120
     AADMQASLGD TVDIVPMATV EPLQMHLELD AVIMGGEYRP AAGITALRFM ADEFGPVATP       180
     SLGATLSSDP AAMGTQTMLI SRSVPKLWDE WFAESGTPPV VFSRTQEFAD LLLALGAARS       240
     GLGIALAPRA SIEDDLERGH LVAPYGFISR PSGYNFCCRT PDVKRPAFAA LSGWLLRCGT       300
     PA                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page