(data stored in ACNUC7421 zone)

EMBL: CP001622.PE484

CP001622.PE484       Location/Qualifiers
FT   CDS             512535..513692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0490"
FT                   /product="Adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="PFAM: S-adenosyl-L-homocysteine hydrolase, NAD
FT                   binding; KEGG: ahcY; adenosylhomocysteinase protein; K01251
FT                   adenosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54796"
FT                   /db_xref="GOA:C6B2H6"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H6"
FT                   /inference="protein motif:PRIAM:3.3.1.1"
FT                   /protein_id="ACS54796.1"
FT                   /translation="MEKSATRIDWIGNSCRLLKATAAEFERTRPFEGLSIGTGIHLEPK
FT                   TVALLTTLRAGGARLVCTGNLNSTQPSTVEFLRTQGISVFATQTTDPAAHHQSLEAVIA
FT                   EKPNLLLDNGGDLFAIAAEKPYANLRGGTEETTSGRIRLLPLRARLNMPILVINDSPIK
FT                   QFAENRHAVGQSLFESYLRFTNRSTNGKRVTVFGYGACGKGTAACFRNAFSTVSVIDID
FT                   PVTTLEAHLDGFTTPLRDAAIRSADIIVTVTGFAGIVTAADLPLVKDGAILMNGGHFPH
FT                   EIDVEAFRRHPDVIGIDRYEADHIETFHLSDGRSFHLLGGGHMANLAGPRPLGNTVESM
FT                   DLGFTLQARCLERIAKGEAGPQSCVVPVPADIDAMVANAYLDLAR"
     MEKSATRIDW IGNSCRLLKA TAAEFERTRP FEGLSIGTGI HLEPKTVALL TTLRAGGARL        60
     VCTGNLNSTQ PSTVEFLRTQ GISVFATQTT DPAAHHQSLE AVIAEKPNLL LDNGGDLFAI       120
     AAEKPYANLR GGTEETTSGR IRLLPLRARL NMPILVINDS PIKQFAENRH AVGQSLFESY       180
     LRFTNRSTNG KRVTVFGYGA CGKGTAACFR NAFSTVSVID IDPVTTLEAH LDGFTTPLRD       240
     AAIRSADIIV TVTGFAGIVT AADLPLVKDG AILMNGGHFP HEIDVEAFRR HPDVIGIDRY       300
     EADHIETFHL SDGRSFHLLG GGHMANLAGP RPLGNTVESM DLGFTLQARC LERIAKGEAG       360
     PQSCVVPVPA DIDAMVANAY LDLAR                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page